DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30098

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:272 Identity:84/272 - (30%)
Similarity:139/272 - (51%) Gaps:20/272 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLVSVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTI 67
            ::|.:..|.:|||  ....:.:.|::.|....|.::.||.:|.  .:.|||.:...:.|.|||::
  Fly     4 AIVLLTFLVILTL--GSYGYSQLLDSKCIALFRIRVIGGQNAR--RTPWMAYLIRDNRFACGGSL 64

  Fly    68 IHMRFVLSAAHCLVRGYDLYVRLG----ARNINEPAAVHTVINVFVHHDFIASEYRN-DIGLLQL 127
            |..||||:||||.....:|:||||    :|..:.....:.|::::.|.::|  ::|| ||.:|:|
  Fly    65 IAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYI--DFRNHDIAVLKL 127

  Fly   128 SESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGN--RNGKLSIMLQTIYLLHLKRNECKRK 190
            ...:||...::||||.|:..|:.....::.|...|||.  ...|:...||.:.|..::...|   
  Fly   128 DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC--- 189

  Fly   191 LNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGVGVYTDVTS 255
               .:.|..||........|.|||||||.:.:.: .:|:..||.|:.:.....|.|...|.|:.|
  Fly   190 ---GVPSLSICCWNPVQYACFGDSGGPLGSLVKY-GHKTIYVQFGVTNSVTGNCDGYSSYLDLMS 250

  Fly   256 YVDWISSTIARN 267
            |:.|:..|:.||
  Fly   251 YMPWLYQTLLRN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/229 (31%)
Tryp_SPc 38..263 CDD:238113 73/231 (32%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 72/228 (32%)
Tryp_SPc 37..258 CDD:238113 73/231 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
65.840

Return to query results.
Submit another query.