DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30090

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:301 Identity:107/301 - (35%)
Similarity:156/301 - (51%) Gaps:29/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLVSVALLSLLTLCVTENEHFKFLETPCGISTRP---KISGGDDAAEPNSIWMAAIFNSSDFQCG 64
            ::.::..|::..||...|.  ::||..||::...   ||.||.||...::.|||.|.:|....||
  Fly     4 AIAAITALAIGVLCSLGNG--EYLEPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICG 66

  Fly    65 GTIIHMRFVLSAAHCLVRGYDLYVRLG------ARNINEPAAV-----HTVINVFVHHDFIASEY 118
            ||:|..||||:||||:..|..:.||||      ..:.|....:     |.|...|.|..|...:.
  Fly    67 GTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKN 131

  Fly   119 RNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWG-NRNGKLSIMLQTIYLLHL 182
            .|||.||:|::.:.:...:.||||.|..:.:..|:.::.|.|.||| .|..:...:||...|...
  Fly   132 LNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRY 196

  Fly   183 KRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDPECRGV 247
            ..::|.:.|...:...|||||....|||.|||||||...:.. .:|...||.|:||:|..||.|:
  Fly   197 NSSQCMQALGRLVQQNQICAGRLGSDTCNGDSGGPLFQTVRH-MDKMRPVQFGVVSYGSRECSGI 260

  Fly   248 GVYTDVTSYVDWISSTIARNDYLPIGVSGGDIAMGNPIAPD 288
            ||||||.||.|||::.:.:|.::|.           ||.|:
  Fly   261 GVYTDVYSYADWIATVVQQNTHVPA-----------PIMPN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 92/234 (39%)
Tryp_SPc 38..263 CDD:238113 93/236 (39%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 92/234 (39%)
Tryp_SPc 40..276 CDD:238113 93/236 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463442
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I7012
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
87.890

Return to query results.
Submit another query.