DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG30088

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:292 Identity:105/292 - (35%)
Similarity:154/292 - (52%) Gaps:39/292 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLVSVALLSLLTLCVTENEHF--KFLETPCGIS----TRPKISGGDDAAEPNSIWMAAIFNSSDF 61
            ||.|.::...:.:|:...|..  .||...||:|    ...:|..|.:|...::.:||.::.||:.
  Fly     4 SLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEI 68

  Fly    62 QCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNI-----------NEPAAVHTVINVFVHHDFIA 115
            .||||||..|::|:||||: |.| |.||||..:|           :.||....::        :|
  Fly    69 HCGGTIISSRYILTAAHCM-RPY-LKVRLGEHDITRNPDCQGGSCSPPAEEFDIV--------LA 123

  Fly   116 SEYR-------NDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKLKTFRALGWGNRNGKLSI- 172
            ::|:       |||.||:||.:|.:.|.:||||:.|:||...:|.:   |:|.|||......|. 
  Fly   124 TKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLILNPAAAPNVHE---FQAFGWGQTETNHSAN 185

  Fly   173 MLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIV 237
            :|||..|.......|:..|:..:...|:|.|.:..|||.|||||||.|.:.:.....| :|||||
  Fly   186 VLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSGGPLVTKVNYDGVWRY-LQLGIV 249

  Fly   238 SFGDPECRGVGVYTDVTSYVDWISSTIARNDY 269
            ||||.:|:..||||.|.:|:.||...:..|.|
  Fly   250 SFGDDKCQSPGVYTYVPNYIRWIRYVMQSNGY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 91/241 (38%)
Tryp_SPc 38..263 CDD:238113 93/243 (38%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 91/241 (38%)
Tryp_SPc 45..273 CDD:238113 92/241 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463393
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4848
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
76.790

Return to query results.
Submit another query.