DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and try-10

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:317 Identity:74/317 - (23%)
Similarity:116/317 - (36%) Gaps:95/317 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SVALLSLLTLCVTENEHFKFLETPCGISTRPKISGGDDAAEPNSIWMAAIF----NSSDFQCGGT 66
            |:..|...|:..|.|.....|..   ||....|..|..|...:::.:|::.    :.:...|||.
 Worm    46 SIRFLKSFTISKTMNFFILLLSF---ISYSTSIINGFSANSFDTLSLASVITRFPDGTTNVCGGV 107

  Fly    67 IIHMRFVLSAAHCLVRGYDL----YVRLGARNINEPAAVHTVINVFVHHDFIASEYR-------- 119
            :|....|:::|||:..|.|.    .|.||..::|:             ||....|:|        
 Worm   108 LIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHLNK-------------HDDGEQEFRSHAMAISK 159

  Fly   120 ---NDIGLLQLSESIVYTVRVQPIC---IFLDPA---LKGSVE----------KLKT--FRALGW 163
               ||........::::..:...:|   :.|..|   ..|||.          :|:|  ....||
 Worm   160 KFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKETAPLTQLQLETSVCYVAGW 224

  Fly   164 GNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQI--------CAGTKNGDTCRGDSGGPLST 220
            |....|.:           |.::..|::..||:.|:|        .|.|.:...|.||||.|:  
 Worm   225 GKTENKTA-----------KYSDSVRQMMVNLSVRRIGKRKYLIAKAVTGSSRACMGDSGSPV-- 276

  Fly   221 NILFPSNKSYEVQLGIV----SFG-----DPE-----CRGVGVYTDVTSYVDWISST 263
             ..|.:.|  .:.:|.|    ||.     ||.     ||.. .||.|:   ||..|:
 Worm   277 -YCFVNGK--RILVGTVAHIGSFSKMSEQDPSNHISFCRDF-EYTFVS---DWRESS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 64/281 (23%)
Tryp_SPc 38..263 CDD:238113 65/283 (23%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 53/243 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.