DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10764 and CG43124

DIOPT Version :9

Sequence 1:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:255 Identity:58/255 - (22%)
Similarity:103/255 - (40%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LETPCGISTRPKISGGDDAAEPNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRGYDLYVRL 90
            ||..| :....:|:|...|.     |:|.|.:.|...|.|.:|:..:||:||.|......|.|||
  Fly    23 LEEDC-VDHMERINGSSYAP-----WLAEILSDSKVICAGALINNLYVLTAASCFKENEKLTVRL 81

  Fly    91 GARNINEPAAVHTVINVFVHHDFIASEYRNDIGLLQLSESIVYTVRVQPICIFLDPALKGSVEKL 155
            |:...::......|...:.......:...|::.:.:|...:.:...::|:||...|.   |:...
  Fly    82 GSGYFDKSYENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPK---SLGLA 143

  Fly   156 KTFRALGWGNRNGKLSIMLQTIYLLHLKRNECKRKLNFNLNSRQICAGTKNGDTCRGDSGGPLST 220
            .||..:   |...|:     ..:..::|...||.....|....|           ...:|.|.:.
  Fly   144 TTFEII---NEKPKM-----WYFCKNIKGLFCKYVFGENEEKWQ-----------SKPTGSPWTE 189

  Fly   221 NILFPSNKSYE--VQLGIVSFGDPECRGVGVYTDVTSYVDW---------ISSTIARNDY 269
            .|   ||..::  |:.||:|:.|.:... .||.:|.|:::|         ||:.:.:.:|
  Fly   190 TI---SNGPFKGLVRYGILSYRDNKTYD-EVYINVMSHINWIAQISLEIDISTPVKKKEY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 52/233 (22%)
Tryp_SPc 38..263 CDD:238113 54/235 (23%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 21/96 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.