DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRE3

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_115960.2 Gene:ADGRE3 / 84658 HGNCID:23647 Length:652 Species:Homo sapiens


Alignment Length:438 Identity:101/438 - (23%)
Similarity:172/438 - (39%) Gaps:97/438 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 DELNKHD--------------PFVNVTLSDG-SVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELP 159
            :|::|.|              |..||:||.. ::..:|.|         ..|...:::.:..:..
Human   255 EEMDKKDQVYLNSQVVSAAIGPKRNVSLSKSVTLTFQHVK---------MTPSTKKVFCVYWKST 310

  Fly   160 GNEFTLFENGSLLRHWDKVELSKREYC-VQHLSFKDDSIRIAPHFCPLSSEHSRTWKT----VAI 219
            |.......:|..|.|.:|    ....| ..|||    |..:   ...|:|:......|    |.:
Human   311 GQGSQWSRDGCFLIHVNK----SHTMCNCSHLS----SFAV---LMALTSQEEDPVLTVITYVGL 364

  Fly   220 VISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYS-SGFC-VTAGF 278
            .:||:|::|....:|..:.:||    ||.:..:|    |||.:...::.:.:.. ...| :.||.
Human   365 SVSLLCLLLAALTFLLCKAIRNTSTSLHLQLSLC----LFLAHLLFLVGIDRTEPKVLCSIIAGA 425

  Fly   279 LGYFSVIAAFFWLSV----ISLTLWNSFSGNSSWLNRFLPQNRF-LSYNLYAWGMALLLTAITYI 338
            |.|. .:|||.|:.:    :.||..|....|.|.:||.:....| :.|.:.|..:|:...:..::
Human   426 LHYL-YLAAFTWMLLEGVHLFLTARNLTVVNYSSINRLMKWIMFPVGYGVPAVTVAISAASWPHL 489

  Fly   339 ADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNF 403
                         .|....||::. |...|..|.||:..|...|:.:|:| .|.|:|.|..:.|.
Human   490 -------------YGTADRCWLHL-DQGFMWSFLGPVCAIFSANLVLFIL-VFWILKRKLSSLNS 539

  Fly   404 TQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYF---NWSQGT 465
            ........|:.:.|.|..||     |:|.:|.|.::       |....|.::|..|   |..||.
Human   540 EVSTIQNTRMLAFKATAQLF-----ILGCTWCLGLL-------QVGPAAQVMAYLFTIINSLQGF 592

  Fly   466 VIFLLFVLRPSTL-----KLLKERIKGGRDEAGASDEHISLQNTKIDP 508
            .|||::.|....:     |..:|.:|      ..|:......::|:.|
Human   593 FIFLVYCLLSQQVQKQYQKWFREIVK------SKSESETYTLSSKMGP 634

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 21/109 (19%)
7tm_4 216..436 CDD:304433 60/234 (26%)
ADGRE3NP_115960.2 EGF_CA 67..104 CDD:238011
GPS 304..344 CDD:280071 10/50 (20%)
7tm_4 353..594 CDD:304433 68/272 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.