DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgrg4a

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_021336868.1 Gene:adgrg4a / 793963 ZFINID:ZDB-GENE-121129-2 Length:1201 Species:Danio rerio


Alignment Length:431 Identity:92/431 - (21%)
Similarity:158/431 - (36%) Gaps:102/431 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QYQKMQKSKCYGDMSED-ELNKHDPFVNVTLSDGS-------VVRRHF--KEDLIVQSDLAKPGC 148
            |:....|.|.:.|.|.: .||.:....:||.:..|       |..||.  |||.    |:.|  |
Zfish   758 QFHFYGKEKLFEDTSSNLTLNSYVVSASVTNATVSELEIPVMVTLRHLQNKEDW----DIVK--C 816

  Fly   149 PRMYFLNHELPGNEFTLFENGSLLRHWD-------KVELSKREYCVQHLSFKDDSIRIAPHF--- 203
            ....|..::..|.             |:       ....::......||:          ||   
Zfish   817 VYWDFNKNDKKGG-------------WNDRGCEIVNSNATQTSCSCDHLT----------HFGVL 858

  Fly   204 -----CPLSSEHSRTWKTVAIV---ISLICIILTISVYLYVEKLRNLHGKCFICYLASLFLGYFF 260
                 .|::.:.......::.|   ||.|.:.:|:..||..||||..:....:..|....||...
Zfish   859 LDISKTPINPKDEWVLTIISYVGCGISSIFLGVTLLTYLAFEKLRRDYPSKILINLCMALLGLNM 923

  Fly   261 LVL-NVW---KYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSY 321
            |.| |.|   ..|:..|:|.....::..:|.|.|:.:.::   |.:.......|.::| :..|.:
Zfish   924 LFLVNSWFASFNSNALCITVAAFQHYFFLATFTWMGLGAI---NMYLALVKVFNSYVP-SYILKF 984

  Fly   322 NLYAWGMALLLTAITYIAD-----QVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVF 381
            ....||:.|.:..:....|     ..:..:.|:.....   || :..|:|..:......:||:|.
Zfish   985 CAVGWGIPLSVVILVLAIDFNSYGTSLSTDLLQESTAF---CW-FKNDVTFYVTVVSFAILIMVC 1045

  Fly   382 NITMFVLTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLR----LFIIMGLSWSLEIISFL 442
            ||.:||:...:|.|::            .|:.:|.::.:...||    |..::||:|   |:.|.
Zfish  1046 NIIVFVVVLVQIHKMR------------VNKPSSSRKGFLHDLRVVASLTFLLGLTW---ILVFF 1095

  Fly   443 LSKNQAWAKA----FMVADYFNWSQGTVIFLLFVLRPSTLK 479
                 .|..|    ..:....|..||..|||.:.|....::
Zfish  1096 -----GWGPAKTPLMYLFSILNSLQGFFIFLFYCLMKDNVR 1131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 26/134 (19%)
7tm_4 216..436 CDD:304433 54/235 (23%)
adgrg4aXP_021336868.1 LamG 50..210 CDD:328935
HsdR <637..>729 CDD:333053
GPS 815..858 CDD:307782 9/67 (13%)
7tmB2_GPR112 871..1138 CDD:320663 65/289 (22%)
TM helix 1 873..898 CDD:320663 6/24 (25%)
TM helix 2 908..930 CDD:320663 6/21 (29%)
TM helix 3 941..968 CDD:320663 5/29 (17%)
TM helix 4 983..999 CDD:320663 3/15 (20%)
TM helix 5 1028..1051 CDD:320663 7/22 (32%)
TM helix 6 1073..1098 CDD:320663 8/32 (25%)
TM helix 7 1102..1127 CDD:320663 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.