DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRL4

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_071442.2 Gene:ADGRL4 / 64123 HGNCID:20822 Length:690 Species:Homo sapiens


Alignment Length:477 Identity:106/477 - (22%)
Similarity:177/477 - (37%) Gaps:125/477 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DFFDTVDISKAPRFSNG----SYLYEGLLIPAHLTAEYDYKLLA------DDSKEKVASHVRGCA 81
            |:.:.....||...|||    :::|...:.|  |.:..|..||.      .:.:|:|.|.|...:
Human   277 DYINIFPKRKAAYDSNGNVAVAFVYYKSIGP--LLSSSDNFLLKPQNYDNSEEEERVISSVISVS 339

  Fly    82 CHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVRRH--------FKEDLI 138
            ....|      |...:::|                  :..|||...|..|:        :..| .
Human   340 MSSNP------PTLYELEK------------------ITFTLSHRKVTDRYRSLCAFWNYSPD-T 379

  Fly   139 VQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKREYCVQHLSFKDDSI--RIAP 201
            :....:..||...|       .||.......:.|.|:..:..|.     ..:..||.:|  ||. 
Human   380 MNGSWSSEGCELTY-------SNETHTSCRCNHLTHFAILMSSG-----PSIGIKDYNILTRIT- 431

  Fly   202 HFCPLSSEHSRTWKTVAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLG--YFF 260
                          .:.|:|||||:.:.|..:.:..::::    :| |...|   ||||.  .|.
Human   432 --------------QLGIIISLICLAICIFTFWFFSEIQSTRTTIH-KNLCC---SLFLAELVFL 478

  Fly   261 LVLNVWKYSSGFC-VTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLY 324
            :.:|. ..:..|| :.||.|.|| .:|||.|:.:..:.|:....|       .:....||..|.|
Human   479 VGINT-NTNKLFCSIIAGLLHYF-FLAAFAWMCIEGIHLYLIVVG-------VIYNKGFLHKNFY 534

  Fly   325 AWGMALLLTAITYIADQVVK--NEKLRPR-VGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMF 386
            .:|         |::..||.  :..|..| .|..|.||:.| :...:..|.||..|||:.|:..|
Human   535 IFG---------YLSPAVVVGFSAALGYRYYGTTKVCWLST-ENNFIWSFIGPACLIILVNLLAF 589

  Fly   387 VLTAFRIMK----VKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQ 447
            .:..:::.:    :|.|...|...:......          |.|..::|.:|...:: .::..:.
Human   590 GVIIYKVFRHTAGLKPEVSCFENIRSCARGA----------LALLFLLGTTWIFGVL-HVVHASV 643

  Fly   448 AWAKAFMVADYFNWSQGTVIFL 469
            ..|..|.|::.|   ||..|||
Human   644 VTAYLFTVSNAF---QGMFIFL 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 38/196 (19%)
7tm_4 216..436 CDD:304433 59/233 (25%)
ADGRL4NP_071442.2 EGF_CA 58..>91 CDD:284955
GAIN 139..330 CDD:293098 12/54 (22%)
GPS 368..412 CDD:280071 8/51 (16%)
7tm_4 424..660 CDD:304433 68/287 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.