DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRG6

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006715579.1 Gene:ADGRG6 / 57211 HGNCID:13841 Length:1251 Species:Homo sapiens


Alignment Length:361 Identity:81/361 - (22%)
Similarity:148/361 - (40%) Gaps:79/361 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 WDKVELSKREY--------CVQHL-SFKDDSIRIAPHF--------CPLSSEH--SRTWKTVAIV 220
            ||   |:|.:.        ||.|. |...:::.:..||        .|.|:..  :|..|.:..:
Human   807 WD---LNKNKSFGGWNTSGCVAHRDSDASETVCLCNHFTHFGVL
MDLPRSASQLDARNTKVLTFI 868

  Fly   221 ------ISLICIILTISVYLYVEKLRNLHGKCFICYL--ASLFLGYFFLVLNVWKYS---SGFCV 274
                  ||.|....|:..|:..||||..:....:..|  |.|||...|| |:.|..|   .|.|:
Human   869 SYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLFLNLLFL-LDGWITSFNVDGLCI 932

  Fly   275 TAGFLGYFSVIAAFFWLSVISLTLWNSF-SGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYI 338
            ....|.:|.::|.|.|:.:.::.::.:. ...::::.|::     |.:.:..||:..|:.::. :
Human   933 AVAVLLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYI-----LKFCIIGWGLPALVVSVV-L 991

  Fly   339 ADQVVKNEKLRPRVGVGKN-----CWIYTGDMTVMIY-----FYGPMLLIIVFNITMFVLTAFRI 393
            |.:  .|.::..:...||.     |||..   .|:.|     ::|.|..:   ||.||::...:|
Human   992 ASR--NNNEVYGKESYGKEKGDEFCWIQD---PVIFYVTCAGYFGVMFFL---NIAMFIVVMVQI 1048

  Fly   394 MKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAK---AFM- 454
            .....:..|.|.:::....|.|       .:.|..::|::|.....        ||..   .|| 
Human  1049 CGRNGKRSNRTLREEVLRNLRS-------VVSLTFLLGMTWGFAFF--------AWGPLNIPFMY 1098

  Fly   455 VADYFNWSQGTVIFLLF-VLRPSTLKLLKERIKGGR 489
            :...||..||..||:.. .::.:..|..::.:..||
Human  1099 LFSIFNSLQGLFIFIFHCAMKENVQKQWRQHLCCGR 1134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 10/45 (22%)
7tm_4 216..436 CDD:304433 54/241 (22%)
ADGRG6XP_006715579.1 CUB 44..147 CDD:238001
LamG 154..338 CDD:304605
GPS 802..847 CDD:280071 10/42 (24%)
7tm_4 864..1111 CDD:304433 62/276 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.