DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgrg11

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_017208200.1 Gene:adgrg11 / 563883 ZFINID:ZDB-GENE-041210-320 Length:793 Species:Danio rerio


Alignment Length:450 Identity:96/450 - (21%)
Similarity:164/450 - (36%) Gaps:114/450 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SEDELNK----HDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRM--YFL------------ 154
            ||.|:.:    :.|...|.|.|...|.:::...|||..:.|:....:.  .||            
Zfish   353 SESEVTETAFIYSPATGVRLIDDPTVLKNYPNALIVPKEAAQQALNQSSNAFLGVFRFPNMSKDA 417

  Fly   155 -NHELPGNEFTLFENGSLLRH-----------------------WDKVELSKREYCV-------- 187
             |.::..||....|.|:.:::                       ||. ..||.::..        
Zfish   418 NNSDVLNNEVYAIEMGTKIKNLSNTINLSFNMSQSTSGTPTCYSWDG-NGSKPDWTTEGCRTVVN 481

  Fly   188 --------QHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILTISVYLYVEKL-RNLH 243
                    :||:|  .::.:||....| .|...|..|....|.....:..:.|.|::..| |...
Zfish   482 GSGITCKCEHLTF--FAVLMAPPDITL-RESDLTALTYITYIGCGLSMFFLGVGLFMHFLMRKAK 543

  Fly   244 GKCFICYLASLFLGYFFL----VLN---VWKYSSGFC-VTAGFLGYFSVIAAFFWLSVISLTLWN 300
            ....:..|.:|||..|.|    :.|   |...:|..| |.|.|| ::.::::|.|.:|.:|.|..
Zfish   544 ATNSVHVLINLFLALFMLNVAFLTNEYVVQAQNSILCRVMAAFL-HYCLLSSFTWFAVEALHLCL 607

  Fly   301 SFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNEKLRPRVGVGKNCWIYTGDM 365
            ..: .::.|..:|     |...:..|.....:.::.:...:..::..:.....| ..|||.  |.
Zfish   608 QMT-KTATLKHYL-----LKITVAGWAPPAFVVSVIFSLGKYGEDNIMTESRNV-TMCWIV--DS 663

  Fly   366 TV-MIYFYGPMLLIIVFNITMFV-----LTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFL 424
            || .:...|....:..|.:..|:     |:..|:.|..|:.     :.|.:....||..|   .|
Zfish   664 TVHYVVNIGYYCFVFTFTLGTFIVVVRWLSMLRMSKWSKDG-----KVKRSGTATSDIST---ML 720

  Fly   425 RLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYF-----NWSQGTVIFLLFV--LRPST 477
            .|..::||:|.:...|:         .|..:..|:     |..||   |.|||  |:.||
Zfish   721 GLCCLLGLTWGISFFSY---------GALRMPSYYIFTILNSLQG---FFLFVYYLKTST 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 28/153 (18%)
7tm_4 216..436 CDD:304433 52/234 (22%)
adgrg11XP_017208200.1 GPS 457..498 CDD:280071 7/43 (16%)
7tm_4 511..759 CDD:304433 60/277 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.