DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg3

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_766624.3 Gene:Adgrg3 / 54672 MGIID:1859670 Length:542 Species:Mus musculus


Alignment Length:282 Identity:57/282 - (20%)
Similarity:119/282 - (42%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 SRTWKTVAIVISLICIILTISVYLYVEKLRNLHG-KCFICYLASLFLGYFFLVLNVWKYSSG--- 271
            |:....|:::.....::|.::....:::.::... |..:....||||.....::||...|.|   
Mouse   267 SQAGSAVSMIFLAFTMVLYVAFRFSLQRFKSEDAPKIHMALSISLFLLNLTFLINVGSSSQGPPA 331

  Fly   272 FC-VTAGFLGYFSVIAAFFW-------LSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGM 328
            .| |.|....|| ::..|.|       |.::::.::|::.|           :.||..:|.|||:
Mouse   332 SCWVRAAIFHYF-LLCVFTWMGLEAFHLYLLAIRVFNTYFG-----------HYFLKLSLLAWGL 384

  Fly   329 ALLL-----TAITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVL 388
            .:|:     ::.:| ....:::::.|..:.:   || :..:..:....:|..|:..:|...:..|
Mouse   385 PVLVVIGAGSSNSY-GVYTIRDQENRTSLEL---CW-FQKEPALYATVHGYFLVTFLFGAVVLAL 444

  Fly   389 TAFRIMKVKKEAQNFTQQQKTTNRLNSDK-QTYALFLRLFIIMGLSWSLEIISFL-LSKNQAWAK 451
            .|::|         ||....|..:..... ::....|.|..::|::|.|.:::.| ||       
Mouse   445 VAWKI---------FTLPSVTAGKGQGPTWKSVLTVLGLSSLVGMTWGLAVLTPLGLS------- 493

  Fly   452 AFMVADYFNWSQGTVIFLLFVL 473
            ...|....|..||..||..|::
Mouse   494 TIYVFTLLNSLQGLFIFCWFII 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 45/237 (19%)
Adgrg3NP_766624.3 GPS 211..250 CDD:280071
7tm_4 262..509 CDD:304433 54/274 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.