DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgre4

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_631877.2 Gene:Adgre4 / 52614 MGIID:1196464 Length:689 Species:Mus musculus


Alignment Length:315 Identity:79/315 - (25%)
Similarity:140/315 - (44%) Gaps:56/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VAIVISLICIILTISVYLYVEKLRN----LHGKCFIC-YLASLFLGYFFLVLNVWKYSSGFCVTA 276
            |.:.:||:|:.|....:|....::|    ||.:..|| :||.|.   |...:|..|......:.|
Mouse   352 VGLSLSLLCLFLAAITFLLCRPIQNTSTTLHLQLSICLFLADLL---FLTGINRTKPKVLCSIIA 413

  Fly   277 GFLGYFSVIAAFFWLSV----ISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITY 337
            |.|.|. .:|:|.|:.:    :.||:.|....|.|...||  :.||: |.: .:|:...:.|::.
Mouse   414 GMLHYL-YLASFMWMFLEGLHLFLTVSNLKVANYSNSGRF--KKRFM-YPV-GYGLPAFIVAVSA 473

  Fly   338 IADQVVKNEKLRPRVGVGKNCW--IYTGDMTVMIY-FYGPMLLIIVFNITMFVLTAFRIMKVKKE 399
            ||..  ||      .|...:||  ::.|    .|: |.||...||:.|:..:.|..: |::.|..
Mouse   474 IAGH--KN------YGTHNHCWLSLHRG----FIWSFLGPAAAIILINLVFYFLIIW-ILRSKLS 525

  Fly   400 AQNFTQQQKTTNRLNSDK-QTYALFLRLFIIMGLSWSLEIISFL-LSKNQAWAKAFMVADYFNWS 462
            :.|     |..:.|...| .|:...::|| ::|.||.:.:..|: :.|......|::.. ..|..
Mouse   526 SLN-----KEVSTLQDTKVMTFKAIVQLF-VLGCSWGIGLFIFIEVGKTVRLIVAYLFT-IINVL 583

  Fly   463 QGTVIFLLFVLRPSTLKL--------LKERIKGGRDEAGASDEH------ISLQN 503
            ||.:||::..|....:::        |::.::....|...|..|      ::|:|
Mouse   584 QGVLIFMVHCLLNRQVRMEYKKWFHRLRKEVESESTEVSHSTTHTKMGLSLNLEN 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 64/231 (28%)
Adgre4NP_631877.2 EGF_CA 77..>105 CDD:214542
GAIN <214..262 CDD:293098
GPS 290..332 CDD:280071
7tm_4 343..588 CDD:304433 70/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.