DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and CG15556

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001247379.1 Gene:CG15556 / 43681 FlyBaseID:FBgn0039821 Length:755 Species:Drosophila melanogaster


Alignment Length:293 Identity:58/293 - (19%)
Similarity:104/293 - (35%) Gaps:95/293 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 VISLICIILTISVYLYVEKLRNLHGKCFICYLASLFLGYFFLVLN-------VWKYSSGFCVTAG 277
            ::.|:.|.:|.:|:.....|.:......:|....|.| .|||:|:       :.:..|..|...|
  Fly   473 LLGLLMIFITAAVFKSFRTLASTKILLNLCAALGLQL-LFFLILSQSHLLEQLEQSESERCTLVG 536

  Fly   278 FLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFL----PQNRFLSYNLYAWGMALLLTAITYI 338
            .:..:.::..|.|:.:|....:..:.       |.:    |::..|...:.||.:.|:.|.:...
  Fly   537 AVMQYLLLVVFSWMFIIGFLQYQRYV-------RVIGVNHPRHYILMSAVAAWTLPLIPTLLVVF 594

  Fly   339 ADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIY--FYG-------PMLLIIVFN------ITMFVL 388
                ::....||...        :.|..::.|  .||       |:.||.|.|      |:..|.
  Fly   595 ----LEPGSYRPNNS--------SMDYPILCYPSGYGLSLGVILPIGLITVANAILVGYISWSVY 647

  Fly   389 TAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAF 453
            ||     :.|....|.|              ..||:.||.::|::|                 .|
  Fly   648 TA-----LFKRDLIFKQ--------------LGLFVLLFFLLGITW-----------------IF 676

  Fly   454 MVADYFNWS-------------QGTVIFLLFVL 473
            .:..||::.             ||.|:||.|::
  Fly   677 GLCTYFDFGRIFAYLFCLTATLQGFVLFLYFIV 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 49/241 (20%)
CG15556NP_001247379.1 7tm_4 481..703 CDD:304433 52/277 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.