DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and mthl5

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster


Alignment Length:476 Identity:94/476 - (19%)
Similarity:180/476 - (37%) Gaps:84/476 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VASHVRGC----ACHLRP---CIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVR 130
            |.|||...    |....|   .:..||.:::.....:|      .::|:.|.|..:..|.|....
  Fly    41 VTSHVTSAGSSTALSSDPNLVLVNKCCEKFEIHVDHEC------QQVNETDYFQPMFTSYGGEQN 99

  Fly   131 RHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKRE----------- 184
            |..|...::  .:...|..:|:.:.|....::..:..:...|||:...|....|           
  Fly   100 RPVKFKFVI--GIPNCGSMQMWPIYHYAGSSDKLVLLDDGRLRHYTNAENEAEERHGIQSDYEED 162

  Fly   185 ----------------YCVQHL--SFKDDSIRIAPHFCPLSSEHSRTWKTVAIV----------- 220
                            ||:...  |..::::..| :.|....|..  |.....:           
  Fly   163 IAGSLEPLYHDYDKGLYCIDKATSSTGEENVLFA-NICLARKEIK--WSDSNFLLRKILNPIFHG 224

  Fly   221 ISLICIILTISVYLYVEKL-RNLHGKCF----ICYLASLFLGYFFLVLNVWKYSSGFCVTAGFLG 280
            |||:.:::...:|..:..| |:|.|...    :|.:.|.......:...:..:.|  .:.|..:.
  Fly   225 ISLVILLVIAIIYFILPTLSRDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVS--FIVADIIL 287

  Fly   281 YFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKN 345
            .||::||||||:.....:|.:|...:.:| |.....::..|:.||||....:.|:...|...:..
  Fly   288 CFSLLAAFFWLNSFGFYIWKTFRSRNVFL-RVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDA 351

  Fly   346 EKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNFTQQQKTT 410
            |..:....||:...|  |.:.:.| |:.|:...|:.||..:|.|       :|.....|...:..
  Fly   352 ESYKQEHMVGEQETI--GWLGICI-FFAPIACTILVNIFFYVTT-------RKLINRRTVYGRIA 406

  Fly   411 NRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQGTVIFLLFVLRP 475
            ::|   |..:.:|..:.::|.::|...|:|:|..:...:|...:     |..|..::..:.|||.
  Fly   407 HKL---KANFIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIVV-----NALQTPLLLYICVLRQ 463

  Fly   476 STLKLLKERIKGGRDEAGASD 496
            ..:..|.::.....:...|:|
  Fly   464 RHVTFLLKKTCCYNEPPSAND 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 28/166 (17%)
7tm_4 216..436 CDD:304433 51/235 (22%)
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 56/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.