DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgrl4

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_998532.2 Gene:adgrl4 / 406676 ZFINID:ZDB-GENE-040426-2689 Length:735 Species:Danio rerio


Alignment Length:346 Identity:81/346 - (23%)
Similarity:140/346 - (40%) Gaps:81/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SLLRHWD-------KVELSKREYCVQHLSFKDDSIRIAPHFCPLSSE-------HSRTWKTV--- 217
            |::.||.       :|..:.......||:          ||..|.|.       |......:   
Zfish   424 SMMGHWSLDGCIRTRVNTTHTSCSCNHLT----------HFAIL
MSSARANLLAHYNVLTRITQL 478

  Fly   218 AIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYS-SGFC-VTA 276
            .:||||||:.:.|..:.:...::|    :| |...|   |||:..|..::.:.|.: ..|| :.|
Zfish   479 GMVISLICLSMCIFTFWFFRDIQNTRTTIH-KNLCC---SLFMAQFIFLIGINKSAHKWFCSLIA 539

  Fly   277 GFLGYFSVIAAFFWLSVISLTLWNSFSG---NSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYI 338
            |.|.|| .:|||.|:.:..:.|:....|   |..:|:|          |.||:|.......:...
Zfish   540 GLLHYF-FLAAFAWMCIEGIHLYLIVVGVIYNKGFLHR----------NFYAFGYGSPAVVVAIS 593

  Fly   339 ADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMK---VKKEA 400
            |....|      ..|....||:.| :...:..|.||.:|||:.|:..|.:..:::.:   |||..
Zfish   594 ATLGYK------YYGTSSVCWLST-ENNFIWSFIGPAILIILVNLLAFAVIIYKVYRHTAVKKPE 651

  Fly   401 QNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQGT 465
            .:..:..::..|         ..:.|..::|::|:..:: ::|.:....|..|..|:.|   ||.
Zfish   652 ISHYENIRSCAR---------GAIALLFVLGVTWAFGVM-YILYETTLTAYLFTFANVF---QGM 703

  Fly   466 VIFLLFVLRPSTLKLLKERIK 486
            .||:.       |.:|..||:
Zfish   704 FIFIF-------LCVLSRRIQ 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 7/40 (18%)
7tm_4 216..436 CDD:304433 57/234 (24%)
adgrl4NP_998532.2 EGF_CA 34..56 CDD:304395
EGF_CA 60..93 CDD:238011
EGF_CA 110..143 CDD:214542
GAIN 188..386 CDD:293098
GPS 416..457 CDD:280071 8/42 (19%)
7tm_4 469..705 CDD:304433 64/270 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.