DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and mthl7

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_648181.2 Gene:mthl7 / 38910 FlyBaseID:FBgn0035847 Length:491 Species:Drosophila melanogaster


Alignment Length:503 Identity:174/503 - (34%)
Similarity:265/503 - (52%) Gaps:50/503 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TAFLLLLLQNSNAEIPGCDFFDTVDISKAPRFSNGSYLYEGLLIPAHLTAEYDYKLLADDSKEKV 73
            |..||:...||||:||||:::||||||...| .|.||||:.:.|||.||..|:::...|.|...:
  Fly    10 TVLLLIFTNNSNADIPGCNYYDTVDISYIER-QNDSYLYDDIEIPASLTGYYEFRQFGDGSITPI 73

  Fly    74 ASHVRGCACHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFV---------NVTLSDGSVV 129
            ..|:|.|.|.:|||||.|||....:...|| .|..::||.:..|::         .|.|:|.:::
  Fly    74 EKHLRACVCSVRPCIRICCPAKNFLANGKC-DDGLKEELARFKPYIYFTYMDLQARVPLTDMAII 137

  Fly   130 RRHFKEDLIVQSDLAKPGCPRMYFL---NHELPGNEFTLFENGSLL------RHWDKVEL--SKR 183
            |..|.:            |..|.::   |:.|......:|....|:      :.|..|:|  .|:
  Fly   138 RDEFFD------------CDEMIYISDFNYFLEEVSIQIFNKCGLIVWFQDGKFWVTVDLFMEKQ 190

  Fly   184 EYCVQHLSFKDD---SIRIAPHFCPLSSEHSRTWKTVAIVISLICIILTISVYLYVEKLRNLHGK 245
            :||:...:|..|   |:.|..|.|   :.|........::|::||.:|||:||||::||||:.||
  Fly   191 DYCLYRHNFDSDFPKSMWIIRHRC---TSHISPGSLEILIITMICFVLTIAVYLYIKKLRNVTGK 252

  Fly   246 CFICYLASLFLGYFFLVLNVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLN 310
            |.:|.:.|.|:....::|:.....:|.|..||:..:|..:|:..||||||...|...:.    ||
  Fly   253 CIVCCIVSRFIQCLIMILDHLNLLNGICSPAGYSSHFFRMASNLWLSVISYHTWKVLTS----LN 313

  Fly   311 RFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNEKLR----PRVGVGKNCWIYTGDMTVMIYF 371
            |..|..|||.||.:.|..|.::|...||.:|:.:|:..:    |.||..: |.:.....:|.||.
  Fly   314 RVDPNYRFLRYNAFVWSTAAIMTGSIYIVNQIWENDPSKWNWLPLVGFIR-CSVKDWHPSVWIYI 377

  Fly   372 YGPMLLIIVFNITMFVLTAFRIMKVKKEAQNFTQQQK-TTNRLNSDKQTYALFLRLFIIMGLSWS 435
            .||.|.:..||:.||.|||..|.|||.....||.::: ..|.:|.|.|||..||||.|:|||:|.
  Fly   378 SGPSLALSTFNVAMFALTAIYIRKVKGGINKFTNEEEGRINCINFDSQTYLQFLRLSIVMGLTWI 442

  Fly   436 LEIISFLLSKNQAWAKAFMVADYFNWSQGTVIFLLFVLRPSTLKLLKE 483
            ..:|.:....:..|....::::||:.:.|.|:|:|.||:.||..|:.:
  Fly   443 FNVIPYSARLHIFWEWVGIISEYFHSAFGIVLFVLLVLKRSTWTLMMD 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 61/200 (31%)
7tm_4 216..436 CDD:304433 88/224 (39%)
mthl7NP_648181.2 Mth_Ecto 27..214 CDD:299804 61/200 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I4416
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5395
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25921
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.