DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrf3

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006535799.1 Gene:Adgrf3 / 381628 MGIID:2685887 Length:1059 Species:Mus musculus


Alignment Length:412 Identity:95/412 - (23%)
Similarity:149/412 - (36%) Gaps:130/412 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GNEFTLFE--------NGSLLRH---WDKVELSKR-----EYCVQHLSFKDDSIRIAPH---FCP 205
            |..||..|        ||:|  |   ||......:     |.|..|.:....:..|..|   |..
Mouse   615 GQAFTQAEVIMDYEDMNGTL--HCVFWDHRVFQGQGGWSDEGCEVHAANASITQCICQHLTAFSI 677

  Fly   206 LSSEH-----------SRTWKTVAIVISLICIILTISVYLYVEKLRN-----LHGKCF---ICYL 251
            |.|:|           |:.....:::..|:|:.:...|:..|  :||     .|...|   ||.|
Mouse   678 LMSQHTVPENPTLDLLSQVGTGASVLALLVCLAIYGLVWRVV--VRNKVAFFRHTTLFNMVICLL 740

  Fly   252 A--SLFLGYFFLVLNVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWN-------------- 300
            .  :.|||..||...   |.|..|:...||.:|..:|.|||:...:|.|.:              
Mouse   741 VADTCFLGSPFLPSG---YHSLICLVTAFLCHFFYLATFFWMLAQALVLAHQLLFVFHQLSKHVV 802

  Fly   301 -------------SFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNEKLRPRV 352
                         .|:|.:  |..:|||.::|      |                          
Mouse   803 LSLMVMLGYLCPLGFAGVT--LGLYLPQRKYL------W-------------------------- 833

  Fly   353 GVGKNCWIYTGDMTVMIY-FYGPMLLIIVFNITMFVLTAFRIMKVK-KEAQNFTQQQKTTNRLNS 415
             .|| |::..|.  ||:| |..|:|.|:..|..:.|:...::::.. .|.....::|.....|.:
Mouse   834 -EGK-CFLNGGG--VMLYSFSEPVLAIVGVNGLVLVIAVLKLLRPSLSEGPTVEKRQALVGVLKA 894

  Fly   416 DKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQGTVIFLLFVLR-PSTLK 479
                   .|.|..|.||:|.|.:.: |...:.....||.:   .|..||..|.:...|. ...|:
Mouse   895 -------LLILTPIFGLTWGLGVAT-LFDGSIVSHYAFSI---LNSLQGVFILVFGCLTDKKVLE 948

  Fly   480 LLKERIKGGRDEAGASDEHISL 501
            .|::|::|.|    :|:..||:
Mouse   949 ALRKRLRGSR----SSNSAISM 966

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 15/62 (24%)
7tm_4 216..436 CDD:304433 58/258 (22%)
Adgrf3XP_006535799.1 HRM 352..398 CDD:367186
GPS 635..678 CDD:366827 9/42 (21%)
7tm_GPCRs 688..954 CDD:391938 70/319 (22%)
TM helix 1 689..714 CDD:341315 3/24 (13%)
TM helix 2 729..751 CDD:341315 8/21 (38%)
TM helix 3 762..789 CDD:341315 9/26 (35%)
TM helix 4 803..823 CDD:341315 2/21 (10%)
TM helix 5 842..871 CDD:341315 10/30 (33%)
TM helix 6 887..914 CDD:341315 8/34 (24%)
TM helix 7 918..943 CDD:341315 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.