DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and mthl8

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001261182.1 Gene:mthl8 / 38013 FlyBaseID:FBgn0052475 Length:492 Species:Drosophila melanogaster


Alignment Length:500 Identity:112/500 - (22%)
Similarity:205/500 - (41%) Gaps:84/500 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CDFFDTVDISKAPRFSNGSYLYEG------LLIPAHLTAEYDYKLLADDSKEKVASHVRGCACHL 84
            |.|.||.:|:       |||..:|      .:||.|..|.||: ::.:..:...:.|:|.|.|..
  Fly    30 CAFIDTANIT-------GSYGLDGPFVHNWTVIPRHFVAVYDF-VIENGIRIPASRHLRACVCKT 86

  Fly    85 RPCIRFCC--PQYQKMQKSKCYGDMS-EDELNKHDPFVNVTLSDGS--VVRRHFKEDLIVQSDLA 144
            :||:|.||  .:...::|.:|...:: ...|..|. .:.|.|.:||  :|:...:..:.|::.  
  Fly    87 KPCVRICCLRGEIYDLEKRQCLVPVAGVSSLPSHS-HMEVELGNGSLRLVKLQPRFSIHVETP-- 148

  Fly   145 KPGCPRMYFLNHELPGNEF---TLFENGSLLRHWDKVELSKREYCVQHLSFKDDSIRIAPHFCPL 206
               |..|..:.   .|:|:   ||.|||::..   :..:..:.||...|...:.:....|..|..
  Fly   149 ---CEHMKAVT---KGSEYVHWTLHENGTISH---RGHIFSKHYCFTPLLHGNSTWEWQPLACAP 204

  Fly   207 SSEH----SRTWK-TVAIVISLICIILTISVYLYVEKLRN-LHGKCFICYLASLFLGYFFLVL-- 263
            ...:    .|.|. .:.::|:::.:.:.:.|||...::|| .:|.....|...:.|||..|..  
  Fly   205 EKLYFVLGVREWTYAICLLIAILSMFIVLMVYLMCSEMRNSFYGVAIKAYAICMILGYALLAYLT 269

  Fly   264 --NVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSG-----NSSWLNRFLPQNRFLSY 321
              |....|:..|.....|...:::.:|:.||.|:..|:.||.|     ...||       .|...
  Fly   270 LHNPANLSNAACRILPSLALMNLVLSFYILSFIAFKLYLSFYGVVFTKLMFWL-------IFTPI 327

  Fly   322 NLYAWGMALLLTAITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMF 386
            .|.|.|.:..: ..:|...:::..         |..||....:.:||||||.|:.:....:...:
  Fly   328 VLVAVGWSFFV-GFSYYGSRLIFG---------GDTCWFDPRNWSVMIYFYAPVFVACAISGFFY 382

  Fly   387 VLTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLS---KNQA 448
            ||:...|     ..|...:.:|:...:  :|..:..|.:.|....:.|.:.|.||..:   :|::
  Fly   383 VLSQIYI-----RDQPDIETEKSFESI--EKNRFKSFWKYFGYTAVVWVVCICSFAFNYYWENRS 440

  Fly   449 ---WAKAFMVADYFNWSQGTVIFLLFVLRPSTLKLLKERIKGGRD 490
               :|.:|.:|.:     |.......:.:...::....||..|.|
  Fly   441 HLNYAVSFCMAFH-----GFAALYALIGKNQQIQNFLRRIDNGED 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 47/191 (25%)
7tm_4 216..436 CDD:304433 50/229 (22%)
mthl8NP_001261182.1 Methuselah_N 30..202 CDD:284145 47/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111500at6656
OrthoFinder 1 1.000 - - FOG0003851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.