DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgre5

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001012164.1 Gene:Adgre5 / 361383 RGDID:1305595 Length:825 Species:Rattus norvegicus


Alignment Length:284 Identity:62/284 - (21%)
Similarity:114/284 - (40%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF---CV 274
            |.:::||:|::|.|..:|.|:.:::    :|....||    ||||....::.|.......   |.
  Rat   543 VGLLLSLVCLLLCILTFLLVKPIQSSRTMVHLHLCIC----LFLGSVIFLVGVENEGGEVGLRCR 603

  Fly   275 TAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAW-------GMALLL 332
            ....|.:|..:|||.|:::..:.|:            ||....|....|..|       |:.||:
  Rat   604 LVAMLLHFCFLAAFCWMALEGVELY------------FLVVRVFQGQGLSTWHRCLVGYGVPLLI 656

  Fly   333 TAITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVK 397
            .||:..|..        ...|....||:.......:..|.||:..||..|..:||:|.:::.|  
  Rat   657 VAISAAARM--------DGYGHATYCWLDFRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTK-- 711

  Fly   398 KEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWS 462
                .|::......:|...:......:...:::|.:|...:  ||.:.:..|..  .:....|..
  Rat   712 ----KFSEINPNMKKLRKARVLTITAIAQLLVLGCTWGFGL--FLFNPHSTWLS--YIFTLLNCL 768

  Fly   463 QGTVIFLLFVLRPSTLKLLKERIK 486
            ||..:::       ||.||.::::
  Rat   769 QGLFLYV-------TLCLLNKKVR 785

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 52/232 (22%)
Adgre5NP_001012164.1 EGF_CA 69..>101 CDD:214542
EGF_CA 171..218 CDD:284955
EGF_CA 220..265 CDD:284955
GPS 487..526 CDD:280071
7tm_2 534..773 CDD:278432 58/263 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.