DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRD2

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001382354.1 Gene:ADGRD2 / 347088 HGNCID:18651 Length:982 Species:Homo sapiens


Alignment Length:363 Identity:79/363 - (21%)
Similarity:133/363 - (36%) Gaps:93/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILT-----------ISVYLY-VEK--- 238
            ||..:..|....||  |.|......|.|....::.:.:..|           |.:.:| |::   
Human   628 HLQHRAQSPLFPPH--PPSPYTGGAWATTGCSVAALYLDSTACFCNHSTSFAILLQIYEVQRGPE 690

  Fly   239 ----LRNLH----GKCFICYLASLFLGYF-------------------------FLVLNVW-KYS 269
                ||.|.    |..| |.|.:.||.:.                         ||:.:.| |.:
Human   691 EESLLRTLSFVGCGVSF-CALTTTFLLFLVAGVPKSERTTVHKNLTFSLASAEGFLMTSEWAKAN 754

  Fly   270 SGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTA 334
            ...||......:|..:.||.|:.|..|.||......|     ..|......|:...||:.:.:.|
Human   755 EVACVAVTVAMHFLFLVAFSWMLVEGLLLWRKVVAVS-----MHPGPGMRLYHATGWGVPVGIVA 814

  Fly   335 ITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFN------ITMFVLTAFRI 393
            :|.   .::.::.:.|     .:||:......:.. |.||:|.::..|      :.|..:::.|.
Human   815 VTL---AMLPHDYVAP-----GHCWLNVHTNAIWA-FVGPVLFVLTANTCILARVVMITVSSARR 870

  Fly   394 MKVKKEAQNFTQQQKTTNRLNSDKQTYAL---FLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMV 455
            .......|...|||..|       |.:|.   .|.|..::||:|   :...|:..:.|||.|   
Human   871 RARMLSPQPCLQQQIWT-------QIWATVKPVLVLLPVLGLTW---LAGILVHLSPAWAYA--- 922

  Fly   456 ADYFNWSQGTVIFLLFV-----LRPSTLKLLKERIKGG 488
            |...|..||..|||::.     :|.:..::.::::..|
Human   923 AVGLNSIQGLYIFLVYAACNEEVRSALQRMAEKKVAEG 960

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 5/14 (36%)
7tm_4 216..436 CDD:304433 57/277 (21%)
ADGRD2NP_001382354.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.