DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg6

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_218313.7 Gene:Adgrg6 / 308376 RGDID:1308551 Length:1248 Species:Rattus norvegicus


Alignment Length:342 Identity:77/342 - (22%)
Similarity:142/342 - (41%) Gaps:68/342 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 CVQHL-SFKDDSIRIAPHF--------CPLSSEH--SRTWKTVAIV------ISLICIILTISVY 233
            ||.|. |...::|.:..||        .|.|:..  .|..|.:..:      ||.|....|:..|
  Rat   820 CVAHSDSDAGETICLCNHFTHFGVL
MDLPRSASQIDGRNTKVLTFITYIGCGISAIFSAATLLTY 884

  Fly   234 LYVEKLRNLHGKCFICYLAS--LFLGYFFLVLNVWKYS---SGFCVTAGFLGYFSVIAAFFWLSV 293
            :..||||..:....:..|:|  |||...|| |:.|..|   :|.|.....|.:|.::|.|.|:.:
  Rat   885 VAFEKLRRDYPSKILMNLSSALLFLNLIFL-LDGWITSFGVAGLCTAVAALLHFFLLATFTWMGL 948

  Fly   294 ISLTLWNSF-SGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNEKLRPRVGVGKN 357
            .::.::.:. ...:::::|::     |.:.:..||:..|:.:|..::.   |..::..:...||:
  Rat   949 EAIHMYIALVKVFNTYIHRYI-----LKFCIIGWGLPALVVSIILVSR---KQNEVYGKESYGKD 1005

  Fly   358 -----CWIYTGDMTVMIY-----FYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNFTQQQKTTNR 412
                 |||..   .|:.|     ::|.|..:   |:.||::...:|.....:..|.|.:::....
  Rat  1006 QDDEFCWIQD---PVVFYVSCAGYFGIMFFL---NVAMFIVVMVQICGRNGKRSNRTLREEVLRN 1064

  Fly   413 LNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAK---AFM-VADYFNWSQGTVIFLLF-V 472
            |.|       .:.|..::|::|.....        ||..   .|| :...||..||..||:.. .
  Rat  1065 LRS-------VVSLTFLLGMTWGFAFF--------AWGPLNIPFMYLFSIFNSLQGLFIFIFHCA 1114

  Fly   473 LRPSTLKLLKERIKGGR 489
            ::.:..|..:..:..||
  Rat  1115 MKENVQKQWRRHLCCGR 1131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 7/26 (27%)
7tm_4 216..436 CDD:304433 53/241 (22%)
Adgrg6XP_218313.7 CUB 38..146 CDD:238001
LamG 178..337 CDD:304605
GPS 799..844 CDD:280071 7/23 (30%)
7tm_4 861..1108 CDD:304433 61/276 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.