DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg5

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_008770523.1 Gene:Adgrg5 / 307645 RGDID:1305559 Length:564 Species:Rattus norvegicus


Alignment Length:131 Identity:31/131 - (23%)
Similarity:52/131 - (39%) Gaps:30/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 PLSSEHSRTWKTVAIV---ISLICIILTISVYLYVEKLR--------NLHGKCFICYLASLFLGY 258
            |:.:|.....:.:::|   ||::..:|||.:..:..||.        ||:|       :.|.|..
  Rat   235 PVPTELQTPLEYISLVGCSISIVASLLTILLNAHSRKLSDSTTRIHLNLNG-------SVLLLNI 292

  Fly   259 FFLVLNVWKYSSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNL 323
            .||:      ||............:|:||....:::|...|....|    .|.:|...|.  ||:
  Rat   293 TFLL------SSQMVPPTVPRSVCTVLAATLHYALLSSLTWMGVEG----FNLYLLLGRV--YNV 345

  Fly   324 Y 324
            |
  Rat   346 Y 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 29/120 (24%)
Adgrg5XP_008770523.1 GPS 184..228 CDD:396408
7tm_GPCRs 243..>349 CDD:421689 29/123 (24%)
TM helix 1 243..268 CDD:410628 6/24 (25%)
TM helix 2 277..299 CDD:410628 8/34 (24%)
TM helix 3 311..338 CDD:410628 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.