DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg7

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001100568.1 Gene:Adgrg7 / 304014 RGDID:1307217 Length:785 Species:Rattus norvegicus


Alignment Length:222 Identity:48/222 - (21%)
Similarity:97/222 - (43%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 SVIAAFFWLSVISLTLWNSFSGNSSWL-----NRFLPQNRFLSYNLYAWGMALLLTAITYIADQV 342
            :.|||.....::....||..|....:.     .:.||::..:..:|..||:..::..:|......
  Rat   523 TAIAALLHYFLLGTFTWNGLSATQLYFLLIRTMKPLPRHFIVIISLVGWGVPAIIVGVTIGIIYA 587

  Fly   343 VKNEKLRPRVGVGKN--CWI---YTGDMT---VMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKE 399
            :...|....:...:.  ||:   ...|..   ::..|..|:.:|::.||.:||:...:::  .|.
  Rat   588 LSGNKSYWELDYRQEEICWLAVPKNNDFARSPLLWSFIMPVTIILITNIAIFVIITVKVL--WKN 650

  Fly   400 AQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADY----FN 460
            .||.|    :|.:::|.|:..:. |.:.::.|::|   |.::.:..|....:  :|..|    ||
  Rat   651 NQNLT----STKKVSSLKKVLST-LSIAVVFGVTW---IFAYAMLINNDDIR--IVFSYIFCLFN 705

  Fly   461 WSQGTVIFLLFVLRPSTL-----KLLK 482
            .:||..||:|:.:|....     |:||
  Rat   706 TTQGLQIFILYTVRTKVFQNEASKILK 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 33/165 (20%)
Adgrg7NP_001100568.1 GPS 378..418 CDD:396408
7tmB2_GPR128 428..727 CDD:320385 45/215 (21%)
TM helix 1 431..455 CDD:320385
TM helix 2 465..486 CDD:320385
TM helix 3 523..545 CDD:320385 6/21 (29%)
TM helix 4 565..581 CDD:320385 3/15 (20%)
TM helix 5 617..640 CDD:320385 5/22 (23%)
TM helix 6 666..688 CDD:320385 4/25 (16%)
TM helix 7 695..720 CDD:320385 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.