DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRD1

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001317426.1 Gene:ADGRD1 / 283383 HGNCID:19893 Length:906 Species:Homo sapiens


Alignment Length:520 Identity:106/520 - (20%)
Similarity:175/520 - (33%) Gaps:149/520 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YLYEGLLIPAHLTAEYDYKLLADDSKEKVASHVRGCACHLRPCIRFCCPQYQKMQKSKCYGDMSE 109
            :.|...:.|||               .|:|.     |.|.:.|:.|.......::.|.       
Human   464 HYYLNNIWPAH---------------TKIAE-----AMHHQDCLLFATSHLISLEVSP------- 501

  Fly   110 DELNKHDPFVNVTLSDGSVVRRHFKEDLI-VQSDLAKPGCPRMY----FL----------NHELP 159
                  .|.::..||...::..|.|..|. .|...|.....|::    ||          ||...
Human   502 ------PPTLSQNLSGSPLITVHLKHRLTRKQHSEATNSSNRVFVYCAFLDFSSGEGVWSNHGCA 560

  Fly   160 ---GN------EFTLFENGSLLRHWDKVELSK-REYCVQHLSFKDDSIRIAPHFCPLSSEHSRTW 214
               ||      ..|...|.::|.....:||:: .:..:..:|:..         |.||       
Human   561 LTRGNLTYSVCRCTHLTNFAILMQVVPLELARGHQVALSSISYVG---------CSLS------- 609

  Fly   215 KTVAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF--C 273
                 |:.|:..::|.:|...|..:||    :|.......|.:.     .|:|..::...|.  |
Human   610 -----VLCLVATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQ-----VLLLISFRLEPGTTPC 664

  Fly   274 VTAGFLGYFSVIAAFFWLSVISLTLWNS----FSGNSSWLNRFLPQNRFLSYNLYAWGMALL--L 332
            .....|.::..::||.|:.|..|.|::.    |....|       ::|:  |....||..||  :
Human   665 QVMAVLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDS-------KHRY--YYGMGWGFPLLICI 720

  Fly   333 TAITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVK 397
            .::::..|.          .|...|||:......:.. |..|.|.:||.||.:.:.....|.:: 
Human   721 ISLSFAMDS----------YGTSNNCWLSLASGAIWA-FVAPALFVIVVNIGILIAVTRVISQI- 773

  Fly   398 KEAQNFTQQQKTTNRLNSDKQTYALFLR----LFIIMGLSWSLEIISFLLSKNQAWAKAFMVADY 458
             .|.|:        :::.|...:.|..:    |..|:|.||   :...|.....|....:|.|. 
Human   774 -SADNY--------KIHGDPSAFKLTAKAVAVLLPILGTSW---VFGVLAVNGCAVVFQYMFAT- 825

  Fly   459 FNWSQGTVIFLLFVLRPSTLK-LLKERIK------GGRDEAGASDEHISLQN--------TKIDP 508
            .|..||..|||...|..|.:: ..|.:.|      .....:.|...|..|.|        ||:.|
Human   826 LNSLQGLFIFLFHCLLNSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSP 890

  Fly   509  508
            Human   891  890

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 32/183 (17%)
7tm_4 216..436 CDD:304433 50/235 (21%)
ADGRD1NP_001317426.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.