DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgre5

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_036055.2 Gene:Adgre5 / 26364 MGIID:1347095 Length:818 Species:Mus musculus


Alignment Length:283 Identity:64/283 - (22%)
Similarity:120/283 - (42%) Gaps:52/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF---CV 274
            |.:::||||::|.|..:|.|:.:::    :|....||    ||||....::.|.......   |.
Mouse   535 VGLLLSLICLLLCILTFLLVKPIQSSRTMVHLHLCIC----LFLGSIIFLVGVENEGGEVGLRCR 595

  Fly   275 TAGFLGYFSVIAAFFWLSVISLTLW----NSFSGN--SSWLNRFLPQNRFLSYNLYAWGMALLLT 333
            ....:.:|..:|||.|:::..:.|:    ..|.|.  |:|      |...:.|     |:.||:.
Mouse   596 LVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTW------QRCLIGY-----GVPLLIV 649

  Fly   334 AITYIADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKK 398
            ||:.   .|||.:    ..|....||:.......:..|.||:..||..|..:||:|.:::.|   
Mouse   650 AISM---AVVKMD----GYGHATYCWLDFRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTK--- 704

  Fly   399 EAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQ 463
               .|::......:|...:......:...:::|.:|...:  ||.:.:..|..  .:....|..|
Mouse   705 ---KFSEINPNMKKLRKARVLTITSIAQLLVLGCTWGFGL--FLFNPHSTWLS--YIFTLLNCLQ 762

  Fly   464 GTVIFLLFVLRPSTLKLLKERIK 486
            |..::::       |.||.::::
Mouse   763 GLFLYVM-------LCLLNKKVR 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 55/231 (24%)
Adgre5NP_036055.2 EGF_CA 69..118 CDD:284955
EGF_CA 165..212 CDD:284955
EGF_CA 214..248 CDD:284955
GPS 480..518 CDD:280071
7tm_2 526..766 CDD:278432 61/262 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 799..818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.