DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg2

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006528869.1 Gene:Adgrg2 / 237175 MGIID:2446854 Length:1092 Species:Mus musculus


Alignment Length:280 Identity:63/280 - (22%)
Similarity:120/280 - (42%) Gaps:67/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 ISLICIILTISVYLYVEKL-RNLHGKCFICYLASLFLGYFFLVLNVW--KYSS-GFCV-TAGFLG 280
            :|.|.:.:|:..|:..||: |:...|..|...|:|.|.....:|:.|  .|:: |||: .|.||.
Mouse   713 LSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLIFLLDSWIALYNTRGFCIAVAVFLH 777

  Fly   281 YFSVIAAFFWLSV----ISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQ 341
            || ::.:|.|:.:    :.|.|...|   ::::.:::     |.:.:..||:..::.:|..    
Mouse   778 YF-LLVSFTWMGLEAFHMYLALVKVF---NTYIRKYI-----LKFCIVGWGIPAVVVSIVL---- 829

  Fly   342 VVKNEKLRP-RVGVGKN-----------CWIYTGDMTVMIYFY----GPMLLIIVFNITMFVLTA 390
                 .:.| ..|:|..           |||.:.     :.||    |...:|.:.|::||::..
Mouse   830 -----TISPDNYGIGSYGKFPNGTPDDFCWINSN-----VVFYITVVGYFCVIFLLNVSMFIVVL 884

  Fly   391 FRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMV 455
            .::.::||:.|...|::.:...|.|       ...|..::|::|.....        ||....:.
Mouse   885 VQLCRIKKKKQLGAQRKTSIQDLRS-------IAGLTFLLGITWGFAFF--------AWGPVNVT 934

  Fly   456 ADY----FNWSQGTVIFLLF 471
            ..|    ||..||..||:.:
Mouse   935 FMYLFAIFNTLQGFFIFIFY 954

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 54/239 (23%)
Adgrg2XP_006528869.1 Atrophin-1 <288..>423 CDD:367360
PRK14948 <368..559 CDD:237862
GPS 637..687 CDD:366827
7tmB2_GPR64 700..969 CDD:320560 63/280 (23%)
TM helix 1 703..727 CDD:320560 4/13 (31%)
TM helix 2 737..758 CDD:320560 6/20 (30%)
TM helix 3 770..792 CDD:320560 7/22 (32%)
TM helix 4 812..828 CDD:320560 2/15 (13%)
TM helix 5 858..881 CDD:320560 6/27 (22%)
TM helix 6 904..929 CDD:320560 6/39 (15%)
TM helix 7 933..958 CDD:320560 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.