DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg4

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001349814.1 Gene:Adgrg4 / 236798 MGIID:2685213 Length:3025 Species:Mus musculus


Alignment Length:414 Identity:92/414 - (22%)
Similarity:157/414 - (37%) Gaps:121/414 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 NKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWD- 176
            |..||.:        ::.:|.:.|                 .|::.....|..|:..:.|..|: 
Mouse  2564 NLADPVI--------IILKHIQGD-----------------WNYDQVYCAFWDFDTNNGLGGWNP 2603

  Fly   177 ---KVELSKREYCV---QHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILTIS---- 231
               |::.|...|.:   .||:          ||..| .:.||:  ||..|...|.:|:|.:    
Mouse  2604 SGCKLKESNINYTICQCNHLT----------HFGVL-MDLSRS--TVDAVNERILVIITYTGCGI 2655

  Fly   232 ----------VYLYVEKLRNLHGKCFICYL--ASLFLGYFFLVLNVWKYS---SGFCVTAGFLGY 281
                      .|:...|||..:....:..|  |.|.|...||| |.|..|   .|.|:||....:
Mouse  2656 SSIFLGIAMVTYIAFHKLRKDYPSKILINLCTALLMLNLAFLV-NSWLTSFQKVGLCITAAVALH 2719

  Fly   282 FSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNE 346
            :.::.:..|:.:.::.::.:.   ....|.::| |..|.:.|..||:..:..||      ::...
Mouse  2720 YFLLVSLTWMGLEAVHMYFAL---VKVFNTYIP-NYILKFCLAGWGIPAITVAI------ILSVR 2774

  Fly   347 K-----LRPRVGVGKNCWI---YTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNF 403
            |     |.|....   |||   :...::|:.||    .||.:.|::||.....::..||      
Mouse  2775 KDLYGTLSPTTPF---CWIKDDHIFYISVVAYF----CLIFLMNLSMFCTVLVQLTSVK------ 2826

  Fly   404 TQQQKTTNR--LNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYF----NWS 462
            :|.|||..:  ||..|.|    :.|..::||:|.....        ||....:...|.    |..
Mouse  2827 SQSQKTRKKMILNDLKGT----ISLTFLLGLTWGFAFF--------AWGPVRIFFLYLFAICNTL 2879

  Fly   463 QGTVIFLLFVLRPSTLKLLKERIK 486
            ||.:||:.:.       ::||.::
Mouse  2880 QGFLIFVFYC-------VMKESVR 2896

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 16/97 (16%)
7tm_4 216..436 CDD:304433 62/248 (25%)
Adgrg4NP_001349814.1 LamG <54..162 CDD:328935
DnaJ <276..746 CDD:333066
GPS 2587..2629 CDD:307782 11/51 (22%)
7tmB2_GPR112 2642..2903 CDD:320663 69/298 (23%)
TM helix 1 2644..2669 CDD:320663 4/24 (17%)
TM helix 2 2679..2701 CDD:320663 8/22 (36%)
TM helix 3 2712..2739 CDD:320663 3/26 (12%)
TM helix 4 2754..2770 CDD:320663 5/21 (24%)
TM helix 5 2793..2816 CDD:320663 7/26 (27%)
TM helix 6 2838..2863 CDD:320663 9/36 (25%)
TM helix 7 2867..2892 CDD:320663 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.