DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRF2

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001355044.1 Gene:ADGRF2 / 222611 HGNCID:18991 Length:708 Species:Homo sapiens


Alignment Length:323 Identity:77/323 - (23%)
Similarity:139/323 - (43%) Gaps:60/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 SLLRHWDK------VELSKREYCVQHLS--FKDDSIRIAPHFCPLSSEHSRTWKT-VAIVISLIC 225
            |:...||:      .|.|::..|....|  |...||.::||   :......|:.| |.:.||:..
Human   399 SVENRWDQQACKMIQENSQQAVCKCRPSKLFTSFSILMSPH---ILESLILTYITYVGLGISICS 460

  Fly   226 IILTISVYLYV------EKLRNLHGKCFICYLASLFLGYFFLVLNVWKYSSGF----------CV 274
            :||.:|:.:.|      .::..|...|.:...|:|      |:.:||...:.|          ||
Human   461 LILCLSIEVLVWSQVTKTEITYLRHVCIVNIAATL------LMADVWFIVASFLSGPITHHKGCV 519

  Fly   275 TAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYA--WGMALLLTAITY 337
            .|.|..:|..::.|||:...:|.:....    ..:...||:: .|..:|::  :|..|.:.|||.
Human   520 AATFFVHFFYLSVFFWMLAKALLILYGI----MIVFHTLPKS-VLVASLFSVGYGCPLAIAAITV 579

  Fly   338 IADQVVKNEKLRPRVGVGKNCWIYTGDMT-VMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKEA- 400
            .|.:..|. .|||.:     ||: ..||| .::.|..|.|.|:|.|:....|.   |:|.::.| 
Human   580 AATEPGKG-YLRPEI-----CWL-NWDMTKALLAFVIPALAIVVVNLITVTLV---IVKTQRAAI 634

  Fly   401 -QNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWS 462
             .:..|:.:...|::.:      ...|..::||:|...:.:.:..::.|:...|.:.:.|..|
Human   635 GNSMFQEVRAIVRISKN------IAILTPLLGLTWGFGVATVIDDRSLAFHIIFSLLNAFQVS 691

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 12/41 (29%)
7tm_4 216..436 CDD:304433 60/241 (25%)
ADGRF2NP_001355044.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.