DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRF4

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001334784.1 Gene:ADGRF4 / 221393 HGNCID:19011 Length:695 Species:Homo sapiens


Alignment Length:380 Identity:71/380 - (18%)
Similarity:142/380 - (37%) Gaps:94/380 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 RHWDKVELSKREYCVQHLSFKDD------SIRIAPHFCPLSSEHSRTWK----------TVAIVI 221
            |.||:      :.|...|..:::      ...:...|..|.|..|.|.|          :|:|:.
Human   357 RRWDE------KACQMMLDIRNEVKCRCNYTSVVMSFSILMSSKSMTDKVLDYITCIGLSVSILS 415

  Fly   222 SLICIILTISVY--LYVEKLRNLHGKCFICYLASLFLGYFFLVLNVW----------KYSSGFCV 274
            .::|:|:..:|:  :.|.::..:...|.:....||      |..|||          ......||
Human   416 LVLCLIIEATVWSRVVVTEISYMRHVCIVNIAVSL------LTANVWFIIGSHFNIKAQDYNMCV 474

  Fly   275 TAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMAL-----LLTA 334
            ...|..:|..::.|||:...:|.:....         .:...|.:...:...|.|:     |:.|
Human   475 AVTFFSHFFYLSLFFWMLFKALLIIYGI---------LVIFRRMMKSRMMVIGFAIGYGCPLIIA 530

  Fly   335 ITYIADQVVKNEK--LRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVK 397
            :|.:|  :.:.||  :||..     ||:...:...::.|..|..:|:..|:.:.::.|..     
Human   531 VTTVA--ITEPEKGYMRPEA-----CWLNWDNTKALLAFAIPAFVIVAVNLIVVLVVAVN----- 583

  Fly   398 KEAQNFTQQQKTTNRLNSDKQTYALFLR-------LFIIMGLSWSLEIISFLLSKNQAWAKAFMV 455
                  ||:....   :|..|...:.:|       |..::||:|...|.:.:...:..:...|.:
Human   584 ------TQRPSIG---SSKSQDVVIIMRISKNVAILTPLLGLTWGFGIATLIEGTSLTFHIIFAL 639

  Fly   456 ADYFNWSQGTVIFLLFVLRPSTLK-LLKERIKGGRDEAGASDEHISLQNTKIDPS 509
            .:.|   ||..|.|...:....:: .|:.|:...:.::.|:      :|..:.|:
Human   640 LNAF---QGFFILLFGTIMDHKIRDALRMRMSSLKGKSRAA------ENASLGPT 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 5/36 (14%)
7tm_4 216..436 CDD:304433 48/245 (20%)
ADGRF4NP_001334784.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 674..695 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.