DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRG5

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001291305.1 Gene:ADGRG5 / 221188 HGNCID:19010 Length:528 Species:Homo sapiens


Alignment Length:562 Identity:108/562 - (19%)
Similarity:188/562 - (33%) Gaps:164/562 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FTAFLLLLLQNSNAEI--PGCDFFDTVDIS--KAPRFS------------NGSYLYEGLLIPAHL 56
            |....||.|||:..|.  ....:.:.:.:|  ::..||            |.|:....|.:....
Human     8 FLCLCLLTLQNATTETWEELLSYMENMQVSRGRSSVFSSRQLHQLEQMLLNTSFPGYNLTLQTPT 72

  Fly    57 TAEYDYKLLADDSKEKVAS------------HVRG------------CACHLRP------CIRFC 91
            .....:||..|.|...:.|            |.||            .||..||      ||.|.
Human    73 IQSLAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFS 137

  Fly    92 CPQYQKMQKSKCYGDMSEDELNK---HDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYF 153
            ...:.|            ||.|.   ::..:...||.|.|  .:.::.:.:.           ::
Human   138 NTHFFK------------DENNSSLLNNYVLGAQLSHGHV--NNLRDPVNIS-----------FW 177

  Fly   154 LNHELPGNEFT--LFENGSLLRHWD-------KVELSKREYCV---QHLSFKDDSIRIAPHFCPL 206
            .|..|.|...|  .::.|:..:.|.       :.|.......:   .||::....::::|...|.
Human   178 HNQSLEGYTLTCVFWKEGARKQPWGGWSPEGCRTEQPSHSQVLCRCNHLTYFAVLMQLSPALVPA 242

  Fly   207 SSEHSRTW-KTVAIVISLICIILTISVYLYVEKL--------RNLHGKCFICYLASLFLGYFFLV 262
            ......|: ..|...||::..::|:.::.:..|.        .|||.       :.|.|...||:
Human   243 ELLAPLTYISLVGCSISIVASLITVLLHFHFRKQSDSLTRIHMNLHA-------SVLLLNIAFLL 300

  Fly   263 LNVWKYS--SGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLY- 324
            ...:..|  .|...||        :||....:::|...|.:..|    .|.:|...|.  ||:| 
Human   301 SPAFAMSPVPGSACTA--------LAAALHYALLSCLTWMAIEG----FNLYLLLGRV--YNIYI 351

  Fly   325 ----------AWGMALLLTAITYIADQVVKNEKLRPRVGVGKN---------CWIYTGDM-TVMI 369
                      .||...||..::......|......|.....:|         ||:.:..: :|::
Human   352 RRYVFKLGVLGWGAPALLVLLSLSVKSSVYGPCTIPVFDSWENGTGFQNMSICWVRSPVVHSVLV 416

  Fly   370 YFYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSW 434
            ..||.  |..:||:.:.....:.:.::::.|      ...:.|...|..|   .|.|.:::|.:|
Human   417 MGYGG--LTSLFNLVVLAWALWTLRRLRERA------DAPSVRACHDTVT---VLGLTVLLGTTW 470

  Fly   435 SLEIISFLLSKNQAWAKAFMVADYF-----NWSQGTVIFLLF 471
            :|...||         ..|::...|     |...|..:||.|
Human   471 ALAFFSF---------GVFLLPQLFLFTILNSLYGFFLFLWF 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 39/236 (17%)
7tm_4 216..436 CDD:304433 50/250 (20%)
ADGRG5NP_001291305.1 GPS 187..232 CDD:307782 6/44 (14%)
7tmB2_GPR114 245..518 CDD:320559 61/300 (20%)
TM helix 1 247..272 CDD:320559 5/24 (21%)
TM helix 2 281..303 CDD:320559 7/28 (25%)
TM helix 3 315..342 CDD:320559 8/38 (21%)
TM helix 4 355..375 CDD:320559 4/19 (21%)
TM helix 5 409..438 CDD:320559 6/30 (20%)
TM helix 6 451..478 CDD:320559 10/38 (26%)
TM helix 7 482..507 CDD:320559 6/22 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.