DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRE1

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_011526096.1 Gene:ADGRE1 / 2015 HGNCID:3336 Length:978 Species:Homo sapiens


Alignment Length:475 Identity:113/475 - (23%)
Similarity:168/475 - (35%) Gaps:165/475 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 YGDMSEDELNKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRM----------------- 151
            |.|:....:||.....||||            ||:.:.|..|.||..:                 
Human   524 YLDIESKVINKECSEENVTL------------DLVAKGDKMKIGCSTIEESESTETTGVAFVSFV 576

  Fly   152 ---------YFLNHELP--GNEFTLFEN----GSLLRHWDKVELS----------------KREY 185
                     :|.:|:.|  .:|..|..|    |.::....|...|                :|..
Human   577 GMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPI 641

  Fly   186 CV---------QHLSF--------------------------------KDDSIRIAPHFCPLSSE 209
            ||         :..||                                .|.|:.|..|       
Human   642 CVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGELTMDFSLYIISH------- 699

  Fly   210 HSRTWKTVAIVISLICIILTISVYLYVEKLRN----LHGKCFICYL--ASLFLGYFFLVLNVWKY 268
                   |.|:|||:|::|.|:.:|....:||    ||....:|.|  .:|||.......|    
Human   700 -------VGIIISLVCLVLAIATFLLCRSIRNHNTYLHLHLCVCLLLAKTLFLAGIHKTDN---- 753

  Fly   269 SSGFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQN-RFLSYNLYAWGMALLL 332
            ..|..:.||||.|. .:|.|||:.|.::.|: ....|...:|.|..:| :.|....:.:|:.:|:
Human   754 KMGCAIIAGFLHYL-FLACFFWMLVEAVILF-LMVRNLKVVNYFSSRNIKMLHICAFGYGLPMLV 816

  Fly   333 TAITYIADQVVKNEKLRPR-VGVGKNCWIYTGDMTVMIY-FYGPMLLIIVFNITMFVLTAF---- 391
                     ||.:..::|: .|:...||:.|  .|..|: |.||:..:||.|..:...|.:    
Human   817 ---------VVISASVQPQGYGMHNRCWLNT--ETGFIWSFLGPVCTVIVINSLLLTWTLWILRQ 870

  Fly   392 RIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVA 456
            |:..|..|....    |.|..|     |:..|.:|| |:|.||.|.|.       |....|.::|
Human   871 RLSSVNAEVSTL----KDTRLL-----TFKAFAQLF-ILGCSWVLGIF-------QIGPVAGVMA 918

  Fly   457 DYF---NWSQGTVIFLLFVL 473
            ..|   |..||..|||:..|
Human   919 YLFTIINSLQGAFIFLIHCL 938

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 32/188 (17%)
7tm_4 216..436 CDD:304433 68/232 (29%)
ADGRE1XP_011526096.1 EGF_CA 33..62 CDD:238011
EGF_CA 80..114 CDD:214542
EGF_CA 132..171 CDD:214542
EGF_CA 172..206 CDD:214542
EGF_CA 224..260 CDD:214542
EGF_CA 264..297 CDD:214542
EGF_CA 313..>342 CDD:214542
EGF_CA 360..400 CDD:284955
GPS 638..687 CDD:197639 5/48 (10%)
7tm_2 691..932 CDD:278432 81/288 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.