DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRF3

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001138640.1 Gene:ADGRF3 / 165082 HGNCID:18989 Length:1079 Species:Homo sapiens


Alignment Length:480 Identity:111/480 - (23%)
Similarity:177/480 - (36%) Gaps:99/480 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 IPAHLTAEYDYKLLADDSKEKVASHVRGCACHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHD 116
            ||.|..|    .|:.:.::..:.|.|.....||.|               ..||....|.|....
Human   637 IPRHSLA----PLVRNGTEISITSLVLRKLDHLLP---------------SNYGQGLGDSLYATP 682

  Fly   117 PFVNV-TLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDK--- 177
            ..|.| ::..|.   |.|.:..::.......|.|...|.:|       :||:...   .|.|   
Human   683 GLVLVISIMAGD---RAFSQGEVIMDFGNTDGSPHCVFWDH-------SLFQGRG---GWSKEGC 734

  Fly   178 ----VELSKREYCV-QHL-SFKDDSIRIAPHFCPLSSEHSRTWKT-VAIVISLICIILTISVYLY 235
                ...|....|: ||| :|   |:.::||..|  .|.:....| |.:..|::.:::.:.||..
Human   735 QAQVASASPTAQCLCQHLTAF---SVLMSPHTVP--EEPALALLTQVGLGASILALLVCLGVYWL 794

  Fly   236 VEK--LRN-----LHG---KCFICYLA--SLFLGYFFLVLNVWKYSSG----FCVTAGFLGYFSV 284
            |.:  :||     .|.   ....|.||  :.|||..||       |.|    .|:.|.||.:|..
Human   795 VWRVVVRNKISYFRHAALLNMVFCLLAADTCFLGAPFL-------SPGPRSPLCLAAAFLCHFLY 852

  Fly   285 IAAFFWLSVISLTLWNS--FSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNEK 347
            :|.|||:...:|.|.:.  |..:....:|.||....|.| |...|:|.:...:.....|.::..:
Human   853 LATFFWMLAQALVLAHQLLFVFHQLAKHRVLPLMVLLGY-LCPLGLAGVTLGLYLPQGQYLREGE 916

  Fly   348 LRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVK-KEAQNFTQQQKTTN 411
                      ||: .|....:..|.||:|.||..|..:..:...::::.. .|.....::|....
Human   917 ----------CWL-DGKGGALYTFVGPVLAIIGVNGLVLAMAMLKLLRPSLSEGPPAEKRQALLG 970

  Fly   412 RLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQGTVIFLLFVLRPS 476
            .:.:       .|.|..|.||:|.|.:.:.|...:......|.:   .|..||..|.|...|.. 
Human   971 VIKA-------LLILTPIFGLTWGLGLATLLEEVSTVPHYIFTI---LNTLQGVFILLFGCLMD- 1024

  Fly   477 TLKLLKERIKGGRDEAGASDEHISL 501
              :.::|.::.....|.|....|||
Human  1025 --RKIQEALRKRFCRAQAPSSTISL 1047

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 36/161 (22%)
7tm_4 216..436 CDD:304433 58/239 (24%)
ADGRF3NP_001138640.1 HRM 431..477 CDD:280888
GPS 713..758 CDD:280071 14/57 (25%)
7tm_4 770..1016 CDD:304433 64/274 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.