DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and Adgrg1

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_006530743.1 Gene:Adgrg1 / 14766 MGIID:1340051 Length:718 Species:Mus musculus


Alignment Length:287 Identity:65/287 - (22%)
Similarity:113/287 - (39%) Gaps:52/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VAIVISLICIILTISVYLYV-EKLRNLHGKCFICYLASLFLGYFFLVLN---VWKYSSGFCVTAG 277
            |..|||.:..:.||:.||.. .|.|:...|..:..|:::||.....:|:   ....|...|.|:.
Mouse   440 VGCVISALACVFTIAAYLCSRRKSRDYTIKVHMNLLSAVFLLDVSFLLSEPVALTGSEAACRTSA 504

  Fly   278 FLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGMALLLTAITYIADQV 342
            ...:||::|...|:   .|..:|.:.........::| ...|..::..||..:.|..:..:.|  
Mouse   505 MFLHFSLLACLSWM---GLEGYNLYRLVVEVFGTYVP-GYLLKLSIVGWGFPVFLVTLVALVD-- 563

  Fly   343 VKN--------EKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKE 399
            |.|        .:...||.....||| ...:...:...|...|:.:||:.|......:|::::..
Mouse   564 VNNYGPIILAVRRTPERVTYPSMCWI-RDSLVSYVTNLGLFSLVFLFNLAMLATMVVQILRLRPH 627

  Fly   400 AQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWS-- 462
            :||:..              ....|.|.:::||.|:|...||.       :..|.:...:.:|  
Mouse   628 SQNWPH--------------VLTLLGLSLVLGLPWALVFFSFA-------SGTFQLVILYLFSII 671

  Fly   463 ---QGTVIFLLF-VLR------PSTLK 479
               ||.:|||.: .:|      ||.||
Mouse   672 TSFQGFLIFLWYWSMRFQAQGGPSPLK 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 50/230 (22%)
Adgrg1XP_006530743.1 PLL 60..193 CDD:376013
GAIN_A 204..251 CDD:376045
GPS 376..419 CDD:366827
7tm_GPCRs 431..698 CDD:391938 63/285 (22%)
TM helix 1 433..458 CDD:341315 7/17 (41%)
TM helix 2 468..490 CDD:341315 5/21 (24%)
TM helix 3 501..528 CDD:341315 7/29 (24%)
TM helix 4 541..561 CDD:341315 4/19 (21%)
TM helix 5 592..621 CDD:341315 5/28 (18%)
TM helix 6 629..656 CDD:341315 9/40 (23%)
TM helix 7 662..687 CDD:341315 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.