powered by:
Protein Alignment mthl3 and LOC108182851
DIOPT Version :9
Sequence 1: | NP_001286526.1 |
Gene: | mthl3 / 36961 |
FlyBaseID: | FBgn0028956 |
Length: | 511 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017210318.1 |
Gene: | LOC108182851 / 108182851 |
-ID: | - |
Length: | 93 |
Species: | Danio rerio |
Alignment Length: | 48 |
Identity: | 15/48 - (31%) |
Similarity: | 26/48 - (54%) |
Gaps: | 6/48 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 424 LRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQGTVIFLLF 471
|..|:::|.|| |:.|..:.::.....|:: .|..|||.|||::
Zfish 5 LAQFVVLGCSW---ILGFFTNSSKVLEILFLI---LNSQQGTFIFLIY 46
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
mthl3 | NP_001286526.1 |
Methuselah_N |
26..204 |
CDD:284145 |
|
7tm_4 |
216..436 |
CDD:304433 |
5/11 (45%) |
LOC108182851 | XP_017210318.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1153592at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.