DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgre14

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_021330419.1 Gene:adgre14 / 108182849 ZFINID:ZDB-GENE-131120-49 Length:505 Species:Danio rerio


Alignment Length:274 Identity:70/274 - (25%)
Similarity:126/274 - (45%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 VISLICII----------LTISVYLYVEKLRNLHGKCFICYLASLFLGY-FFLV----LNVWKYS 269
            |::::|:|          ||.:...:...:.|: .:..||  .||.|.: .||:    |::.:..
Zfish   219 VLNVVCVIVGLLFFSLALLTFTRCQWSPGVNNV-ARINIC--ISLLLAHLLFLLTQQFLSLIRRQ 280

  Fly   270 SGFCVTAGFLGYFSVIAAFFWLSVISLTLW---NSFSGNSSWLNRFLPQNRFLSYNLYAWGMALL 331
            ...|:....|.:|..::.|.|:.:.::.|:   .:.|..||.:...| :|:.|....||  :||:
Zfish   281 KVLCMLISGLLHFLFLSGFVWMFIEAVLLFICVKNLSQISSQMKNVL-RNKLLCVIGYA--VALV 342

  Fly   332 LTAITYIADQVVKNEKLRPRVGVG-KNCWI--YTGDMTVMIY-FYGPMLLIIVFNITMFVLTAFR 392
            :.:   |:..||.|       |.| :.|||  :.|    .|: |.||:.:||..|:.:|:...|.
Zfish   343 VVS---ISAAVVPN-------GYGSEKCWIQMHKG----FIWSFLGPVTIIIALNVILFISIGFS 393

  Fly   393 IMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVAD 457
            :    |.|  |.:.....::||..|......|..|:::|.||   |:.|..:.::.....|::  
Zfish   394 L----KSA--FKKLNADVSQLNQTKIVMFKTLAQFVVLGCSW---ILGFFTNSSKVLEILFLI-- 447

  Fly   458 YFNWSQGTVIFLLF 471
             .|..|||.|||::
Zfish   448 -LNSQQGTFIFLIY 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 60/237 (25%)
adgre14XP_021330419.1 GPS 167..205 CDD:197639
7tm_GPCRs 214..476 CDD:333717 70/274 (26%)
TM helix 1 217..241 CDD:320095 5/21 (24%)
TM helix 2 250..271 CDD:320095 8/23 (35%)
TM helix 3 285..307 CDD:320095 4/21 (19%)
TM helix 4 331..347 CDD:320095 5/20 (25%)
TM helix 5 365..388 CDD:320095 8/26 (31%)
TM helix 6 412..435 CDD:320095 8/25 (32%)
TM helix 7 439..464 CDD:320095 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.