DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgrf3a

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_021322955.1 Gene:adgrf3a / 101886922 ZFINID:ZDB-GENE-131121-607 Length:949 Species:Danio rerio


Alignment Length:516 Identity:104/516 - (20%)
Similarity:187/516 - (36%) Gaps:155/516 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NSNAEIPGCDFFDTVDISK----APRFSNGSYLYEGL-----LIPAHLTAEYDYKLLADDSKEKV 73
            :|||::..|:.....||.|    :.|.|:.|.:..|.     ::|         |...:||...:
Zfish   516 SSNAQMALCNHTSPADICKTFNASVRNSDNSVVVFGFRNLYQILP---------KAEGNDSNTTI 571

  Fly    74 ASHVRGCACHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVRR------- 131
                                             :|...:|.::...::||...|..:|       
Zfish   572 ---------------------------------LSVTPVNANNTNRSITLEFDSAKQRLPNHMIY 603

  Fly   132 --HFKEDLIVQSDLAKPGC-------PRMYFLNHELPGNEFTLF--ENGSLLRHWDKVELSKREY 185
              ::.|:|   ::.:..||       |.:...:|   .:.||:.  :|...|.:.|::       
Zfish   604 CVYWDENL---NEWSSDGCRWAGVDNPTLCICDH---NSAFTILMSKNAETLPYMDEL------- 655

  Fly   186 CVQHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAI-VISLI-CIILTISVYLYVEK--LRNL-HGK 245
                                       |:..:.| ::||: |:|:.:.|:..|.|  :.|. |..
Zfish   656 ---------------------------TYAGLGISILSLLACLIIKVLVWDAVVKSPISNFRHVA 693

  Fly   246 CFICYLASLFLGYFFLVLNVWKYSS---GFCVTAGFLGYFSVIAAFFWLSVISLTLWNSFSGNSS 307
            .|...|..|.....||..:  |..|   .:|.....:.:|..:|.|||:..:|..|.:..    .
Zfish   694 LFNISLCLLLAHCMFLTTS--KPESIPPNWCSILTLIKHFFFLAVFFWMLCLSFVLLHQM----I 752

  Fly   308 WLNRFLPQNRFLSYNL-YAWGMALLLTAITYIADQVVKNEKLRPRVGVGKNCWI-YTGDMTVMIY 370
            ::...|.:..||..:: ..:...::..|:|||:    .|............||: |.|.:...|:
Zfish   753 YVFDRLRKKVFLGLSITVGYACPIIAVAVTYIS----FNNGAEGEYYSKSTCWLTYKGTLKGSIF 813

  Fly   371 FYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWS 435
            .:...:..||| :.:|.| |..|||:   |.....:.|..:..:..|......:.|..::||||.
Zfish   814 AFIIPIGAIVF-VNLFTL-AVVIMKI---ATPSISEAKARDEKDVAKSMIKTIVFLSPVLGLSWV 873

  Fly   436 LEIISFLLSKN---QAWAKAFMVADY----FNWSQGTVIFLLFV-------LRPSTLKLLK 482
            |..  |:|..:   :.||   .:.:|    ||..||  :|:|..       :|.:.||..|
Zfish   874 LGF--FVLGLDLTVKPWA---ALVNYSFTIFNSLQG--LFILLTNCVGEKKVRDALLKRFK 927

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 29/204 (14%)
7tm_4 216..436 CDD:304433 55/229 (24%)
adgrf3aXP_021322955.1 GPS 604..641 CDD:307782 8/42 (19%)
7tm_GPCRs 649..926 CDD:333717 73/332 (22%)
TM helix 1 652..676 CDD:320095 7/57 (12%)
TM helix 2 691..712 CDD:320095 6/20 (30%)
TM helix 3 723..745 CDD:320095 5/21 (24%)
TM helix 4 766..782 CDD:320095 1/15 (7%)
TM helix 5 805..831 CDD:320095 7/27 (26%)
TM helix 6 855..881 CDD:320095 9/27 (33%)
TM helix 7 890..915 CDD:320095 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.