DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and ADGRG2

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001073327.1 Gene:ADGRG2 / 10149 HGNCID:4516 Length:1017 Species:Homo sapiens


Alignment Length:287 Identity:65/287 - (22%)
Similarity:124/287 - (43%) Gaps:65/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 ISLICIILTISVYLYVEKL-RNLHGKCFICYLASLFLGYFFLVLNVW--KYS-SGFCVT-AGFLG 280
            :|.|.:.:|:..|:..||: |:...|..|...|:|.|.....:|:.|  .|. .|.|:: |.||.
Human   638 LSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLVFLLDSWIALYKMQGLCISVAVFLH 702

  Fly   281 YFSVIAAFFWLSV----ISLTLWNSFSGNSSWLNRFLPQNRFLSYNLYAWGM-ALLLTAITYIAD 340
            || ::.:|.|:.:    :.|.|...|   ::::.:::     |.:.:..||: |:::|.|..|:.
Human   703 YF-LLVSFTWMGLEAFHMYLALVKVF---NTYIRKYI-----LKFCIVGWGVPAVVVTIILTISP 758

  Fly   341 QVVKNEKLRPRVGVGKN-----------CWIYTGD---MTVMIYFYGPMLLIIVFNITMFVLTAF 391
            .         ..|:|..           |||....   :||:.||    .:|.:.|::||::...
Human   759 D---------NYGLGSYGKFPNGSPDDFCWINNNAVFYITVVGYF----CVIFLLNVSMFIVVLV 810

  Fly   392 RIMKVKKEAQNFTQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVA 456
            ::.::||:.|...|::.:...|.|       ...|..::|::|.....        ||....:..
Human   811 QLCRIKKKKQLGAQRKTSIQDLRS-------IAGLTFLLGITWGFAFF--------AWGPVNVTF 860

  Fly   457 DY----FNWSQGTVIFLLFVLRPSTLK 479
            .|    ||..||..||:.:.:....::
Human   861 MYLFAIFNTLQGFFIFIFYCVAKENVR 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 56/238 (24%)
ADGRG2NP_001073327.1 GPS 569..612 CDD:280071
7tm_4 625..875 CDD:304433 63/273 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.