DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgre13

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_021327151.1 Gene:adgre13 / 100538238 ZFINID:ZDB-GENE-150505-3 Length:303 Species:Danio rerio


Alignment Length:263 Identity:59/263 - (22%)
Similarity:112/263 - (42%) Gaps:33/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 VAIVISLICIILTISVYLYVEKLRNLHGKCFICYLASLFLGY-FFLV----LNVWKYSSGFCVTA 276
            |.:::.|:...|.:..:.:.:....::....|....||.|.: .||:    |::.:.....|...
Zfish    21 VCVIVGLLFFSLALLTFAFCQWGPGVNNVARINICISLLLAHLLFLLTQQFLSLIRRQQMLCEVI 85

  Fly   277 GFLGYFSVIAAFFWLSVISLTLWNSFSGNSSWLNRFLPQNRFLSYNLY--AWGMALLLTAITYIA 339
            ..|.:|..::.|.|:.:.::.|:.....    |::...|.|.:..|::  ..|.|:.|..:...|
Zfish    86 SGLLHFLFLSGFVWMFIEAVLLFICVKN----LSQISSQKRNVLRNIFLCVIGYAVALVVVGISA 146

  Fly   340 DQVVKNEKLRPRVGVG-KNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNF 403
            ..|.|        |.| :.|||.. |...:..|.||:.:|:..|:.:|:.....:    |.|  |
Zfish   147 AVVPK--------GYGSEKCWIKM-DKGFIWSFLGPVTVILALNVILFIGIGVSL----KSA--F 196

  Fly   404 TQQQKTTNRLNSDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVADYFNWSQGTVIF 468
            .:.....::||..|......|..|:::|.||   |:.|..:.::.....|::   .|..|||.||
Zfish   197 KKLNADVSQLNQTKIIMFKTLAQFVVLGCSW---ILGFFTNSSKVLEILFLI---LNSQQGTFIF 255

  Fly   469 LLF 471
            |::
Zfish   256 LIY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145
7tm_4 216..436 CDD:304433 49/226 (22%)
adgre13XP_021327151.1 7tm_GPCRs 12..274 CDD:333717 59/263 (22%)
TM helix 1 15..39 CDD:320095 3/17 (18%)
TM helix 2 48..69 CDD:320095 6/20 (30%)
TM helix 3 83..105 CDD:320095 4/21 (19%)
TM helix 4 129..145 CDD:320095 3/15 (20%)
TM helix 5 163..186 CDD:320095 6/22 (27%)
TM helix 6 210..233 CDD:320095 8/25 (32%)
TM helix 7 237..262 CDD:320095 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153592at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.