DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl3 and adgrf11

DIOPT Version :9

Sequence 1:NP_001286526.1 Gene:mthl3 / 36961 FlyBaseID:FBgn0028956 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_005160858.1 Gene:adgrf11 / 100537132 ZFINID:ZDB-GENE-121214-165 Length:691 Species:Danio rerio


Alignment Length:382 Identity:84/382 - (21%)
Similarity:138/382 - (36%) Gaps:83/382 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWD------K 177
            ||.||.:.|.|....::.|         |.|:..|.|..              |..||      |
Zfish   297 VNQTLQNISFVFDTTEQSL---------GNPQCVFWNFH--------------LSTWDSTGCEVK 338

  Fly   178 VELSKRE-------YCVQHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAI-VISL-ICIILTISVY 233
            ..||:.|       .|....||   |:.::|.|....:....|:..:.| |:|| |.:|:...|:
Zfish   339 PNLSEEEKIDKITCECNHTTSF---SLLMSPFFIDDKALDYITYTGLGISVLSLVISLIIGAIVW 400

  Fly   234 LYVEKLRN--LHGKCFICYLASLFLGYFFLVLNVWKYSSGF------CVTAGFLGYFSVIAAFFW 290
            ..|.|..:  |...|.:....||.:.....::.......|.      |....|..:...:|.|||
Zfish   401 TTVTKSNSAYLRHVCLVNTNVSLLVADVCFIIGASIVQPGQLAPVGPCTAVAFSMHLFFLAFFFW 465

  Fly   291 LSVISLTLWNSFSGNSSWLNR--FLPQNRFLSYNLYAWGMALLLTAITYIADQVVKNEKLRPRVG 353
            :.:.::.|....:...|.::|  .:....||.|     |..||:..|||         .|..|.|
Zfish   466 MLISAMLLLYMTTMVYSQMSRAKMMAIAFFLGY-----GAPLLIVVITY---------GLTAREG 516

  Fly   354 ----VGKNCWIYTGDMTVMIYFYGPMLLIIVFNITMFVLTAFRIMKVKKEAQNFTQQQKTTNRLN 414
                ....||:...:...:..|..........|:.:.::..::::.|:|      ||.|.||.|.
Zfish   517 KYILEADVCWLNFDETKALQIFVSLASSFTAVNVLIIIVVLYKMLIVRK------QQNKETNILP 575

  Fly   415 SDKQTYALFLRLFIIMGLSWSLEIISFLLSKNQAWAKAFMVAD----YFNWSQGTVI 467
            :..:...:...||   |::|.|. |..:||.:......|.:.:    .||...|.::
Zfish   576 TVTRVVLIVSPLF---GVTWGLG-IGTMLSPDYGIHLVFTILNSLQGIFNLVSGLLV 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl3NP_001286526.1 Methuselah_N 26..204 CDD:284145 23/97 (24%)
7tm_4 216..436 CDD:304433 51/235 (22%)
adgrf11XP_005160858.1 GAIN 143..>227 CDD:293098
GPS 318..363 CDD:280071 14/61 (23%)
7tm_4 374..620 CDD:304433 57/269 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.