DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRE5

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_510966.1 Gene:ADGRE5 / 976 HGNCID:1711 Length:835 Species:Homo sapiens


Alignment Length:604 Identity:120/604 - (19%)
Similarity:210/604 - (34%) Gaps:182/604 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FFDTV-DISKAPRFSNGSYLYEGL--LIPAHLTAEYDYKLLADDSKEKVASHVRGCACHLRPCIR 86
            |||.| |:.:..:.|:.....:.:  |:...:.|..|.:.||...:..:|:.:   ..:|...:|
Human   278 FFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQL---LSNLEDIMR 339

  Fly    87 FCCPQYQKMQKSKCYGDMSEDEL-----NKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCP 146
            .......|...:  |...|..||     .:.|.  |||:...|.   ..|.:..|.:....||..
Human   340 ILAKSLPKGPFT--YISPSNTELTLMIQERGDK--NVTMGQSSA---RMKLNWAVAAGAEDPGPA 397

  Fly   147 RMYFLNHELPGNEFTLFENGSLLRHWDK--------------VELSKRE---------------- 181
            ....|:.:   |..||..|.||..|..|              |:|.:..                
Human   398 VAGILSIQ---NMTTLLANASLNLHSKKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELN 459

  Fly   182 ----YCVQHLS---------------------------FKDDSIR---IAPHFCP-LSSEHSRT- 210
                :...||.                           :|.||.|   .|...|. |.|::..| 
Human   460 SPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTT 524

  Fly   211 --------------------WK-----TVAIVISLICIILTISVYLYVEKLR----NLHGKCFIC 246
                                ||     .|.:.:||.|::|.|..:|.|..::    .:|....||
Human   525 CQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCIC 589

  Fly   247 YLASLFLGYFFLVLNVWKYSSGF---C-VTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLH 307
                ||:|....:..:.......   | :.||.| ::..:|||.|:|:.|:.|            
Human   590 ----LFVGSTIFLAGIENEGGQVGLRCRLVAGLL-HYCFLAAFCWMSLEGLEL------------ 637

  Fly   308 RLLPENPFRAYN-------LYAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVM 365
            ..|....|:...       |..:|:||::..::..   :......|||.     ||: ..:...:
Human   638 YFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAA---IYSKGYGRPRY-----CWL-DFEQGFL 693

  Fly   366 IYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSW 430
            ..|.||:..:|..|.::||.:   ::.:.:....:....:..::.....:.|| .:|| |:|.:|
Human   694 WSFLGPVTFIILCNAVIFVTT---VWKLTQKFSEINPDMKKLKKARALTITAI-AQLF-LLGCTW 753

  Fly   431 SFEILSFLLTKQQAWARALMVADYF---NWSQGTIIFVLFILKPSILK-------LIIAGGRQ-- 483
            .|.:..|       ..|:|::...|   |..||..:::|..|....::       .::|||.:  
Human   754 VFGLFIF-------DDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYS 811

  Fly   484 ----NLPGSHHNSRSKAAR 498
                ...|:.|| :::|.|
Human   812 EFTSTTSGTGHN-QTRALR 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 46/247 (19%)
7tm_4 213..>385 CDD:304433 42/186 (23%)
ADGRE5NP_510966.1 EGF_CA 64..99 CDD:284955
EGF_CA 116..>148 CDD:214542
EGF_CA 160..207 CDD:284955
EGF_CA 209..243 CDD:284955
GPS 493..536 CDD:280071 9/42 (21%)
7tm_2 544..782 CDD:278432 60/275 (22%)
ProP 608..>785 CDD:223553 44/210 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 814..835 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.