DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRG1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_005256294.1 Gene:ADGRG1 / 9289 HGNCID:4512 Length:698 Species:Homo sapiens


Alignment Length:406 Identity:86/406 - (21%)
Similarity:147/406 - (36%) Gaps:111/406 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PRMYFLNHELPGNEFTL-----FENGSLLR--HWDKV--ELSKRE-----YCVQHLSF------- 189
            |.:....|:|.....||     .|:.:|..  ||...  |..:||     :| .||::       
Human   333 PVVLTFQHQLQPKNVTLQCVFWVEDPTLSSPGHWSSAGCETVRRETQTSCFC-NHLTYFAVLMVS 396

  Fly   190 --KDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILTISVYL--------------YVEKLR- 237
              :.|::.  .|:..|.|       .|..|:|.:..::||:.||              |..|:. 
Human   397 SVEVDAVH--KHYLSLLS-------YVGCVVSALACLVTIAAYLCSRVPLPCRRKPRDYTIKVHM 452

  Fly   238 NLHGKCFICYLASLFLGYFFLV---LNVWKYSSGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKF 299
            ||       .||...|...||:   :.:....:|...:|.|| :||::....|:.:.|.:     
Human   453 NL-------LLAVFLLDTSFLLSEPVALTGSEAGCRASAIFL-HFSLLTCLSWMGLEGYN----- 504

  Fly   300 SLASNCLHRLLPENPFRAY--------NLYAWGIPLIMTAITYTADQ------VVKNEKLRPRVG 350
                  |:||:.| .|..|        :...||.|:.:..:....|.      ::...:....|.
Human   505 ------LYRLVVE-VFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVI 562

  Fly   351 VGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQM 415
            ....||| ...:...|...|...|:..||:.|.....:.|..::.      |.|:.:..:.    
Human   563 YPSMCWI-RDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRP------HTQKWSHVLT---- 616

  Fly   416 FAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYFN---WSQGTIIFVLFILKPSILKLI 477
               .|.|.:::||.|:....||.....|     |:|...|:   ..||.:||:.:    ..::|.
Human   617 ---LLGLSLVLGLPWALIFFSFASGTFQ-----LVVLYLFSIITSFQGFLIFIWY----WSMRLQ 669

  Fly   478 IAGGRQNLPGSHHNSR 493
            ..||...|..:..::|
Human   670 ARGGPSPLKSNSDSAR 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 17/77 (22%)
7tm_4 213..>385 CDD:304433 44/203 (22%)
ADGRG1XP_005256294.1 GPS 349..393 CDD:280071 11/44 (25%)
7tm_4 408..659 CDD:304433 62/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.