DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgrd1

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_001070157.3 Gene:Adgrd1 / 689257 RGDID:1594795 Length:903 Species:Rattus norvegicus


Alignment Length:431 Identity:93/431 - (21%)
Similarity:160/431 - (37%) Gaps:106/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 PFVNVTLSDGSVVRRHFKEDLIVQSDL-AKPGCPRMY----FLNHELPGNEFTLFENGSLLRHWD 173
            |.::..||...::..|.:..|..:..: |.....|::    |||          |.:|..:  |.
  Rat   500 PTLSQNLSGSPLITVHLRHKLTQKQYVDATNESNRLFLYCAFLN----------FSSGEGV--WS 552

  Fly   174 KVELSKRE--------YCVQHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIV---ISLICI---I 224
            ....:..|        :|. ||:.....:::.|  ..|:..|.....:::.|   :|::|:   :
  Rat   553 SQGCALTEGNLTYSVCHCT-HLTNFAILMQVVP--LKLTLGHQVALSSISYVGCSLSVLCLAATL 614

  Fly   225 LTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF--CVTAGFLGYFSVMA 283
            :|.:|...|..:||    :|.......|.:.     .|:|..:....|.  |.....|.::..:.
  Rat   615 VTFAVLSSVSTIRNQRYHIHANLSFAVLVAQ-----VLLLISFSMEPGTVPCQVLAVLLHYFFLT 674

  Fly   284 AFFWLSVIGIHLR---IKFSLASNCLHRLLPENPFRAYNLY----AWGIPLIMTAITYTADQVVK 341
            ||.|:.|.|:||.   ||...:.:..|            ||    .||.||::..|:.::..   
  Rat   675 AFAWMLVEGLHLYSMVIKVFGSEDSKH------------LYYYGIGWGCPLLICIISVSSSM--- 724

  Fly   342 NEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQT 406
                 ...|.|.:||:......:.. |.||.||:|..||::.|.....|.:|..: ...:|    
  Rat   725 -----DSYGTGDSCWLSVESGAIWA-FVGPALLVIVVNIVILVAVTRVISHISTD-SYKIH---- 778

  Fly   407 NQQINDQQMFAIFLR----LFILMGLSWSFEILSFLLTKQQAWARALMVADYF---NWSQGTIIF 464
                .|...|.:..:    |..::|.||.|.:|:       ...|||:....|   |.|||..||
  Rat   779 ----GDPSAFKLTAKAVAVLLPILGTSWVFGVLA-------VSDRALVFQYMFAILNSSQGLFIF 832

  Fly   465 VLFILKPSILKLIIAGGRQNLPGSHHNSRSKAARYNSTHTA 505
            :...|..|.::...          .|..:..:...:|.|||
  Rat   833 LFHCLLNSEVRAAF----------KHKMKVWSLTSSSAHTA 863

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 18/99 (18%)
7tm_4 213..>385 CDD:304433 44/190 (23%)
Adgrd1XP_001070157.3 LamG <173..273 CDD:304605
GPS 539..579 CDD:280071 10/52 (19%)
7tm_4 595..831 CDD:304433 64/277 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.