DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and ADGRL4

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_071442.2 Gene:ADGRL4 / 64123 HGNCID:20822 Length:690 Species:Homo sapiens


Alignment Length:493 Identity:113/493 - (22%)
Similarity:176/493 - (35%) Gaps:153/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DFFDTVDISKAPRFSNG----SYLYEGLLIPAHLTAEYDYKLLA------DDSKEKVASHVRGCA 78
            |:.:.....||...|||    :::|...:.|  |.:..|..||.      .:.:|:|.|.|...:
Human   277 DYINIFPKRKAAYDSNGNVAVAFVYYKSIGP--LLSSSDNFLLKPQNYDNSEEEERVISSVISVS 339

  Fly    79 CHLRPCIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVRRH--------FKEDLI 135
            ....|      |...:::|                  :..|||...|..|:        :..| .
Human   340 MSSNP------PTLYELEK------------------ITFTLSHRKVTDRYRSLCAFWNYSPD-T 379

  Fly   136 VQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKREYCVQHLSFKDDSI--RIAP 198
            :....:..||...|       .||.......:.|.|:..:..|.     ..:..||.:|  ||. 
Human   380 MNGSWSSEGCELTY-------SNETHTSCRCNHLTHFAILMSSG-----PSIGIKDYNILTRIT- 431

  Fly   199 HFCPLSSEHSRTWKTVAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLG--YFF 257
                          .:.|:|||||:.:.|..:.:..::::    :| |...|   ||||.  .|.
Human   432 --------------QLGIIISLICLAICIFTFWFFSEIQSTRTTIH-KNLCC---SLFLAELVFL 478

  Fly   258 LVLNVWKYSSGFC-VTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLY 321
            :.:|. ..:..|| :.||.|.|| .:|||.|:.:.||||.                         
Human   479 VGINT-NTNKLFCSIIAGLLHYF-FLAAFAWMCIEGIHLY------------------------- 516

  Fly   322 AWGIPLIMTAITYTADQVVKN----EKLRPRVGVG-------------KNCWIYTGDMTVMIYFY 369
                 ||:..:.|....:.||    ..|.|.|.||             |.||:.| :...:..|.
Human   517 -----LIVVGVIYNKGFLHKNFYIFGYLSPAVVVGFSAALGYRYYGTTKVCWLST-ENNFIWSFI 575

  Fly   370 GPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEI 434
            ||..|:|..|::.|   .:.||.:.::..||..:....:.|......|  |.|..|:|.:|.|.:
Human   576 GPACLIILVNLLAF---GVIIYKVFRHTAGLKPEVSCFENIRSCARGA--LALLFLLGTTWIFGV 635

  Fly   435 LSFLLTKQQAWARALMVADYF----NWSQGTIIFVLFI 468
            |..:        .|.:|..|.    |..||..|| ||:
Human   636 LHVV--------HASVVTAYLFTVSNAFQGMFIF-LFL 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 38/196 (19%)
7tm_4 213..>385 CDD:304433 52/195 (27%)
ADGRL4NP_071442.2 EGF_CA 58..>91 CDD:284955
GAIN 139..330 CDD:293098 12/54 (22%)
GPS 368..412 CDD:280071 8/51 (16%)
7tm_4 424..660 CDD:304433 74/300 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.