DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and adgrf7

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_017208207.1 Gene:adgrf7 / 613165 ZFINID:ZDB-GENE-041001-214 Length:694 Species:Danio rerio


Alignment Length:384 Identity:84/384 - (21%)
Similarity:157/384 - (40%) Gaps:64/384 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KEDLIVQSDL----AKPGCPRMYFL---NHELPGNEFTLFENGSLLRHWD----KVELSKRE--- 181
            |.|:.:..||    |......|.|:   ..:..||...:|.|.: |..||    :|:..:.|   
Zfish   321 KPDMRINGDLVVVKANQTLHSMSFVFDTTDQSLGNPQCVFWNFN-LSAWDSTGCEVKPGRNETGI 384

  Fly   182 ---YCVQHLSFKDDSIRIAPHFCPLSSEH-SRTWKT-VAIVISLICIILTISVYLYVEKLRNLHG 241
               .|....||   ||.::    |.|.:| :..:.| :.:.||:.|:||.:.:...|.|....:.
Zfish   385 ITCECNHTASF---SILMS----PFSIDHIAFAYVTYIGVGISVACLILCLIIEAIVWKAVRRND 442

  Fly   242 KCFICYLASLFLGYFFLVLNVWKYSSGF-------------CVTAGFLGYFSVMAAFFW--LSVI 291
            ..::.:::.:.:....|:.:|. :..|.             |.:..|..:|..:|.|||  :|.:
Zfish   443 TSYMRHVSIVNIAISLLIADVC-FIIGAAILDEEQLTPADRCSSVVFFMHFFYLALFFWMLISAL 506

  Fly   292 GIHLRIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKN-C 355
            .:..|:...|:.....:::..:     .|..:|.||:::.||..:       .:.|::.|.|. |
Zfish   507 LLFYRVVMVLSQMSRAKMMVIS-----FLLGYGAPLLISVITVAS-------TVGPQMYVSKQAC 559

  Fly   356 WIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFL 420
            |:...:...::.|..|.|.::|.|:::|:   :.:|.|.|...|...:......:...:..|.|.
Zfish   560 WLNWNESRNLLAFVIPALTIVAINLVVFI---VVLYKIFKRRAGAATQPDWKNALVVARCVAFFT 621

  Fly   421 RLFILMGLSWSFEILSFLLTKQQAWARALMVADYFNWSQGTIIFVLFILKPSILKLIIA 479
            .. :..|::|.|.|    .|...|.....:|...||..||..|.|...|..|.::..:|
Zfish   622 PA-LACGITWGFGI----GTTVSAGLFVHVVFALFNSLQGFFILVFGTLLDSKVRKELA 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 21/86 (24%)
7tm_4 213..>385 CDD:304433 38/188 (20%)
adgrf7XP_017208207.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.