DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and adgrg11

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_017208200.1 Gene:adgrg11 / 563883 ZFINID:ZDB-GENE-041210-320 Length:793 Species:Danio rerio


Alignment Length:440 Identity:91/440 - (20%)
Similarity:163/440 - (37%) Gaps:104/440 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SEDELNK----HDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRM--YFL------------ 151
            ||.|:.:    :.|...|.|.|...|.:::...|||..:.|:....:.  .||            
Zfish   353 SESEVTETAFIYSPATGVRLIDDPTVLKNYPNALIVPKEAAQQALNQSSNAFLGVFRFPNMSKDA 417

  Fly   152 -NHELPGNEFTLFENGSLLRH-----------------------WDKVELSKREYCV-------- 184
             |.::..||....|.|:.:::                       ||. ..||.::..        
Zfish   418 NNSDVLNNEVYAIEMGTKIKNLSNTINLSFNMSQSTSGTPTCYSWDG-NGSKPDWTTEGCRTVVN 481

  Fly   185 --------QHLSFKDDSIRIAPHFCPLSSEHSRTWKTVAIVISLICIILTISVYLYVEKL-RNLH 240
                    :||:|  .::.:||....| .|...|..|....|.....:..:.|.|::..| |...
Zfish   482 GSGITCKCEHLTF--FAVLMAPPDITL-RESDLTALTYITYIGCGLSMFFLGVGLFMHFLMRKAK 543

  Fly   241 GKCFICYLASLFLGYFFL----VLN---VWKYSSGFC-VTAGFLGYFSVMAAFFWLSVIGIHLRI 297
            ....:..|.:|||..|.|    :.|   |...:|..| |.|.|| ::.::::|.|.:|..:||.:
Zfish   544 ATNSVHVLINLFLALFMLNVAFLTNEYVVQAQNSILCRVMAAFL-HYCLLSSFTWFAVEALHLCL 607

  Fly   298 KFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKNCWIYTGDM 362
            :.:..:...|.||      ...:..|..|..:.::.::..:..::..:.....| ..|||.  |.
Zfish   608 QMTKTATLKHYLL------KITVAGWAPPAFVVSVIFSLGKYGEDNIMTESRNV-TMCWIV--DS 663

  Fly   363 TV-MIYFYGPMLLLIAFNIIMFVLSAIYIYNI---KKNVKGLVHKQQTNQQINDQQMFAIFLRLF 423
            || .:...|....:..|.:..|::...::..:   |.:..|.|.:..|  ..:|   .:..|.|.
Zfish   664 TVHYVVNIGYYCFVFTFTLGTFIVVVRWLSMLRMSKWSKDGKVKRSGT--ATSD---ISTMLGLC 723

  Fly   424 ILMGLSWSFEILSFLLTKQQAWARALMVADYF-----NWSQGTIIFVLFI 468
            .|:||:|.....|:         .||.:..|:     |..||..:||.::
Zfish   724 CLLGLTWGISFFSY---------GALRMPSYYIFTILNSLQGFFLFVYYL 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 28/153 (18%)
7tm_4 213..>385 CDD:304433 40/181 (22%)
adgrg11XP_017208200.1 GPS 457..498 CDD:280071 7/43 (16%)
7tm_4 511..759 CDD:304433 59/271 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.