DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgrg3

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_766624.3 Gene:Adgrg3 / 54672 MGIID:1859670 Length:542 Species:Mus musculus


Alignment Length:305 Identity:61/305 - (20%)
Similarity:119/305 - (39%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SRTWKTVAIVISLICIILTISVYLYVEKLRNLHG-KCFICYLASLFLGYFFLVLNVWKYSSG--- 268
            |:....|:::.....::|.::....:::.::... |..:....||||.....::||...|.|   
Mouse   267 SQAGSAVSMIFLAFTMVLYVAFRFSLQRFKSEDAPKIHMALSISLFLLNLTFLINVGSSSQGPPA 331

  Fly   269 FC-VTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAY--------NLYAWG 324
            .| |.|....|| ::..|.|:.:...||            .||....|..|        :|.|||
Mouse   332 SCWVRAAIFHYF-LLCVFTWMGLEAFHL------------YLLAIRVFNTYFGHYFLKLSLLAWG 383

  Fly   325 IPLIMTAITYTADQ----VVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVL 385
            :|:::.....:::.    .:::::.|..:.:   || :..:..:....:|..|:...|..::..|
Mouse   384 LPVLVVIGAGSSNSYGVYTIRDQENRTSLEL---CW-FQKEPALYATVHGYFLVTFLFGAVVLAL 444

  Fly   386 SAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALM 450
            .|..|:.:.....|      ..|....:.:..: |.|..|:|::|...:|:.|      ....:.
Mouse   445 VAWKIFTLPSVTAG------KGQGPTWKSVLTV-LGLSSLVGMTWGLAVLTPL------GLSTIY 496

  Fly   451 VADYFNWSQGTIIFVLFILK--PSILKLIIAGGRQNLPGSHHNSR 493
            |....|..||..||..||:.  |:......:.|...|..:|..|:
Mouse   497 VFTLLNSLQGLFIFCWFIILYFPTQSTTASSSGTARLDQAHSVSQ 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145
7tm_4 213..>385 CDD:304433 35/188 (19%)
Adgrg3NP_766624.3 GPS 211..250 CDD:280071
7tm_4 262..509 CDD:304433 52/271 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.