DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgre4

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_631877.2 Gene:Adgre4 / 52614 MGIID:1196464 Length:689 Species:Mus musculus


Alignment Length:330 Identity:81/330 - (24%)
Similarity:140/330 - (42%) Gaps:61/330 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 VAIVISLICIILTISVYLYVEKLRN----LHGKCFIC-YLASLFLGYFFLVLNVWKYSSGFCVTA 273
            |.:.:||:|:.|....:|....::|    ||.:..|| :||.|.   |...:|..|......:.|
Mouse   352 VGLSLSLLCLFLAAITFLLCRPIQNTSTTLHLQLSICLFLADLL---FLTGINRTKPKVLCSIIA 413

  Fly   274 GFLGYFSVMAAFFWLSVIGIHL-----RIKFSLASNCLHRLLPENPFRAYNLY--AWGIPLIMTA 331
            |.|.|. .:|:|.|:.:.|:||     .:|.:..||       ...|:...:|  .:|:|..:.|
Mouse   414 GMLHYL-YLASFMWMFLEGLHLFLTVSNLKVANYSN-------SGRFKKRFMYPVGYGLPAFIVA 470

  Fly   332 ITYTADQVVKNEKLRPRVGVGKNCW--IYTGDMTVMIY-FYGPMLLLIAFNIIMFVLSAIYIYNI 393
            ::..|..  ||      .|...:||  ::.|    .|: |.||...:|..|::.:.|   .|:.:
Mouse   471 VSAIAGH--KN------YGTHNHCWLSLHRG----FIWSFLGPAAAIILINLVFYFL---IIWIL 520

  Fly   394 KKNVKGLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYF--- 455
            :..:..| :|:.:..|......|...::||:| |.||...:..|:...:..   .|:||..|   
Mouse   521 RSKLSSL-NKEVSTLQDTKVMTFKAIVQLFVL-GCSWGIGLFIFIEVGKTV---RLIVAYLFTII 580

  Fly   456 NWSQGTIIFVLFILKPSILKLIIAGGRQNLPGSHHNSRSKAARYNSTHTA----------C-EGS 509
            |..||.:||::..|....:::........| .....|.|....:::|||.          | .|:
Mouse   581 NVLQGVLIFMVHCLLNRQVRMEYKKWFHRL-RKEVESESTEVSHSTTHTKMGLSLNLENFCPTGN 644

  Fly   510 IADPN 514
            :.||:
Mouse   645 LHDPS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145
7tm_4 213..>385 CDD:304433 48/185 (26%)
Adgre4NP_631877.2 EGF_CA 77..>105 CDD:214542
GAIN <214..262 CDD:293098
GPS 290..332 CDD:280071
7tm_4 343..588 CDD:304433 68/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.