DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and mthl5

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001287291.1 Gene:mthl5 / 41438 FlyBaseID:FBgn0037960 Length:497 Species:Drosophila melanogaster


Alignment Length:454 Identity:93/454 - (20%)
Similarity:174/454 - (38%) Gaps:85/454 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VASHVRGC----ACHLRP---CIRFCCPQYQKMQKSKCYGDMSEDELNKHDPFVNVTLSDGSVVR 127
            |.|||...    |....|   .:..||.:::.....:|      .::|:.|.|..:..|.|....
  Fly    41 VTSHVTSAGSSTALSSDPNLVLVNKCCEKFEIHVDHEC------QQVNETDYFQPMFTSYGGEQN 99

  Fly   128 RHFKEDLIVQSDLAKPGCPRMYFLNHELPGNEFTLFENGSLLRHWDKVELSKRE----------- 181
            |..|...::  .:...|..:|:.:.|....::..:..:...|||:...|....|           
  Fly   100 RPVKFKFVI--GIPNCGSMQMWPIYHYAGSSDKLVLLDDGRLRHYTNAENEAEERHGIQSDYEED 162

  Fly   182 ----------------YCVQHL--SFKDDSIRIAPHFCPLSSEHSRTWKTVAIV----------- 217
                            ||:...  |..::::..| :.|....|..  |.....:           
  Fly   163 IAGSLEPLYHDYDKGLYCIDKATSSTGEENVLFA-NICLARKEIK--WSDSNFLLRKILNPIFHG 224

  Fly   218 ISLICIILTISVYLYVEKL-RNLHGKCF----ICYLASLFLGYFFLVLNVWKYSSGFCVTAGFLG 277
            |||:.:::...:|..:..| |:|.|...    :|.:.|.......:...:..:.|  .:.|..:.
  Fly   225 ISLVILLVIAIIYFILPTLSRDLVGNIVTTIAMCLMVSQAADLVRIFTELTSHVS--FIVADIIL 287

  Fly   278 YFSVMAAFFWLSVIGIHLRIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKN 342
            .||::||||||:..|.::...|. :.|...|:.....:..|:.||||....|.|:...|...:..
  Fly   288 CFSLLAAFFWLNSFGFYIWKTFR-SRNVFLRVTDGRKYCYYSAYAWGCTATMAALAVFAHFFLDA 351

  Fly   343 EKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVKG-LVHKQQT 406
            |..:....||:...|  |.:.:.| |:.|:...|..||..:|.:...|.  ::.|.| :.||.:.
  Fly   352 ESYKQEHMVGEQETI--GWLGICI-FFAPIACTILVNIFFYVTTRKLIN--RRTVYGRIAHKLKA 411

  Fly   407 NQQINDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYFNWSQGTIIFVLFILK 470
            |        |.:|..:.::|.::|.|.|:|:|..:...:|..::     |..|..::..:.:|:
  Fly   412 N--------FIMFSLMLLVMSIAWLFLIMSWLQMEGLLYAHIVV-----NALQTPLLLYICVLR 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 28/166 (17%)
7tm_4 213..>385 CDD:304433 43/187 (23%)
mthl5NP_001287291.1 7tm_4 212..451 CDD:304433 60/259 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.