DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and adgrl4

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_998532.2 Gene:adgrl4 / 406676 ZFINID:ZDB-GENE-040426-2689 Length:735 Species:Danio rerio


Alignment Length:327 Identity:84/327 - (25%)
Similarity:139/327 - (42%) Gaps:71/327 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 SLLRHWD-------KVELSKREYCVQHLSFKDDSIRIAPHFCPLSSE-------HSRTWKTV--- 214
            |::.||.       :|..:.......||:          ||..|.|.       |......:   
Zfish   424 SMMGHWSLDGCIRTRVNTTHTSCSCNHLT----------HFAIL
MSSARANLLAHYNVLTRITQL 478

  Fly   215 AIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYS-SGFC-VTA 273
            .:||||||:.:.|..:.:...::|    :| |...|   |||:..|..::.:.|.: ..|| :.|
Zfish   479 GMVISLICLSMCIFTFWFFRDIQNTRTTIH-KNLCC---SLFMAQFIFLIGINKSAHKWFCSLIA 539

  Fly   274 GFLGYFSVMAAFFWLSVIGIHL-RIKFSLASN--CLHRLLPENPFRAYNLYA--WGIPLIMTAIT 333
            |.|.|| .:|||.|:.:.|||| .|...:..|  .|||          |.||  :|.|.::.||:
Zfish   540 GLLHYF-FLAAFAWMCIEGIHLYLIVVGVIYNKGFLHR----------NFYAFGYGSPAVVVAIS 593

  Fly   334 YTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKNVK 398
            .|...        ...|....||:.| :...:..|.||.:|:|..|::.|   |:.||.:.::. 
Zfish   594 ATLGY--------KYYGTSSVCWLST-ENNFIWSFIGPAILIILVNLLAF---AVIIYKVYRHT- 645

  Fly   399 GLVHKQQTNQQINDQQMFAIFLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYFNWSQGTII 463
             .|.|.:.:...|.:......:.|..::|::|:|.:: ::|.:....|.....|:.|   ||..|
Zfish   646 -AVKKPEISHYENIRSCARGAIALLFVLGVTWAFGVM-YILYETTLTAYLFTFANVF---QGMFI 705

  Fly   464 FV 465
            |:
Zfish   706 FI 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 7/40 (18%)
7tm_4 213..>385 CDD:304433 55/185 (30%)
adgrl4NP_998532.2 EGF_CA 34..56 CDD:304395
EGF_CA 60..93 CDD:238011
EGF_CA 110..143 CDD:214542
GAIN 188..386 CDD:293098
GPS 416..457 CDD:280071 8/42 (19%)
7tm_4 469..705 CDD:304433 71/268 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.