DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl4 and Adgre5

DIOPT Version :9

Sequence 1:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001012164.1 Gene:Adgre5 / 361383 RGDID:1305595 Length:825 Species:Rattus norvegicus


Alignment Length:269 Identity:61/269 - (22%)
Similarity:110/269 - (40%) Gaps:45/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 VAIVISLICIILTISVYLYVEKLRN----LHGKCFICYLASLFLGYFFLVLNVWKYSSGF---CV 271
            |.:::||:|::|.|..:|.|:.:::    :|....||    ||||....::.|.......   |.
  Rat   543 VGLLLSLVCLLLCILTFLLVKPIQSSRTMVHLHLCIC----LFLGSVIFLVGVENEGGEVGLRCR 603

  Fly   272 TAGFLGYFSVMAAFFWLSVIGIHL-----RIKFSLASNCLHRLLPENPFRAYNLYAWGIPLIMTA 331
            ....|.:|..:|||.|:::.|:.|     |:......:..||.          |..:|:||::.|
  Rat   604 LVAMLLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTWHRC----------LVGYGVPLLIVA 658

  Fly   332 ITYTADQVVKNEKLRPRVGVGKNCWIYTGDMTVMIYFYGPMLLLIAFNIIMFVLSAIYIYNIKKN 396
            |:..|..        ...|....||:.......:..|.||    :||  |:|..:||::..:.|.
  Rat   659 ISAAARM--------DGYGHATYCWLDFRKQGFLWSFSGP----VAF--IIFCNAAIFVITVWKL 709

  Fly   397 VKGLVHKQQTNQQINDQQMFAI-FLRLFILMGLSWSFEILSFLLTKQQAWARALMVADYFNWSQG 460
            .|.........:::...::..| .:...:::|.:|.|.:  ||......|...:..  ..|..||
  Rat   710 TKKFSEINPNMKKLRKARVLTITAIAQLLVLGCTWGFGL--FLFNPHSTWLSYIFT--LLNCLQG 770

  Fly   461 TIIFVLFIL 469
            ..::|...|
  Rat   771 LFLYVTLCL 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145
7tm_4 213..>385 CDD:304433 45/182 (25%)
Adgre5NP_001012164.1 EGF_CA 69..>101 CDD:214542
EGF_CA 171..218 CDD:284955
EGF_CA 220..265 CDD:284955
GPS 487..526 CDD:280071
7tm_2 534..773 CDD:278432 59/261 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.